Bone Alkaline Phosphatase (Rat), Polyclonal Antibody
Bone Alkaline Phosphatase, also known as bone-specific alkaline phosphatase, is expressed in osteoblasts during bone formation and is thought to play a role in skeletal mineralization. Takara Bio's Bone Specific Alkaline Phosphatase (Rat), Polyclonal antibody was raised against a conjugate of the KLH (keyhole limpet hemocyanin) immunogen and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN], which is highly conserved between human and rat bone specific alkaline phosphatase.
Overview
-
Specificity: rat bone-specific alkaline phosphatase
-
Cross reactivity:
-
Mouse antigens
-
Human antigens (slight reactivity)
-
-
Form: Lyophilized
More Information
Applications
-
Western blot analysis (non-reducing conditions)
-
Immunohistochemical detection of paraffin-embedded tissue sections (no antigen retrieval needed)
Alternative names
AKP2, alkaline phosphatase, alkaline phosphatase liver/bone/kidney isozyme antibody, Alpl, AP-TNAP, HOPS, Liver/bone/kidney isozyme, PHOA, PPBT_HUMAN, tissue non specific alkaline phosphatase, tissue nonspecific ALP, tissue-nonspecific isozyme, TNAP, TNSALP
Additional product information
Please see the product's Certificate of Analysis for information about storage conditions, product components, and technical specifications. Please see the Kit Components List to determine kit components. Certificates of Analysis and Kit Components Lists are located under the Documents tab.
Takara Bio USA, Inc.
United States/Canada: +1.800.662.2566 • Asia Pacific: +1.650.919.7300 • Europe: +33.(0)1.3904.6880 • Japan: +81.(0)77.565.6999
FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES. © 2024 Takara Bio Inc. All Rights Reserved. All trademarks are the property of Takara Bio Inc. or its affiliate(s) in the U.S. and/or other countries or their respective owners. Certain trademarks may not be registered in all jurisdictions. Additional product, intellectual property, and restricted use information is available at takarabio.com.