Home › Products › Antibodies and ELISA › Primary antibodies and ELISAs by research area › Bone research › Bone specific alkaline phosphatase

Bone Alkaline Phosphatase (Rat), Polyclonal Antibody

Bone Alkaline Phosphatase, also known as bone-specific alkaline phosphatase, is expressed in osteoblasts during bone formation and is thought to play a role in skeletal mineralization. Takara Bio's Bone Specific Alkaline Phosphatase (Rat), Polyclonal antibody was raised against a conjugate of the KLH (keyhole limpet hemocyanin) immunogen and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN], which is highly conserved between human and rat bone specific alkaline phosphatase.

Cat. #	Product	Size	Price	License	Quantity	Details
M190	Bone Specific Alkaline Phosphatase (Rat), Polyclonal	0.1 mg	USD $548.00
This product was raised against conjugate of KLH and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] that illustrates an exceptional homology with human and rat Bone Specific Alkaline Phosphatase. Notice to purchaser Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval. Documents Components

Overview

Specificity: rat bone-specific alkaline phosphatase
Cross reactivity:
- Mouse antigens
- Human antigens (slight reactivity)
Form: Lyophilized

More Information

Applications

Western blot analysis (non-reducing conditions)
Immunohistochemical detection of paraffin-embedded tissue sections (no antigen retrieval needed)

Alternative names

AKP2, alkaline phosphatase, alkaline phosphatase liver/bone/kidney isozyme antibody, Alpl, AP-TNAP, HOPS, Liver/bone/kidney isozyme, PHOA, PPBT_HUMAN, tissue non specific alkaline phosphatase, tissue nonspecific ALP, tissue-nonspecific isozyme, TNAP, TNSALP

Additional product information

Please see the product's Certificate of Analysis for information about storage conditions, product components, and technical specifications. Please see the Kit Components List to determine kit components. Certificates of Analysis and Kit Components Lists are located under the Documents tab.

Takara Bio USA, Inc.
United States/Canada: +1.800.662.2566 • Asia Pacific: +1.650.919.7300 • Europe: +33.(0)1.3904.6880 • Japan: +81.(0)77.565.6999
FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES. © 2024 Takara Bio Inc. All Rights Reserved. All trademarks are the property of Takara Bio Inc. or its affiliate(s) in the U.S. and/or other countries or their respective owners. Certain trademarks may not be registered in all jurisdictions. Additional product, intellectual property, and restricted use information is available at takarabio.com.