We use cookies to improve your browsing experience and provide meaningful content. Read our cookie policy. Accept
  •  Customer Login
  • Register
  •  View Cart (0)
  •  Customer Login
  • Register
  •  View Cart (0)

  • Products
  • Services & Support
  • Learning centers
  • APPLICATIONS
  • About
  • Contact Us

Close

  • ‹ Back to Antibodies and ELISA
  • Primary antibodies and ELISAs by research area
    • Bone research
    • Cancer and inflammation
    • Cell adhesion and ECM
    • Environmental hazards
    • Epigenetic antibodies
    • Metabolic diseases
    • Signal transduction
    • Stem cell research antibodies
    • Virus research
    • Miscellaneous research areas
  • Secondary antibodies
  • Antibody and ELISA accessories
  • Fluorescent protein antibodies
Home › Products › Antibodies and ELISA › Primary antibodies and ELISAs by research area

Antibodies and ELISA

  • Primary antibodies and ELISAs by research area
    • Bone research
      • Bone specific alkaline phosphatase
      • Collagen type 2
      • Dentin matrix protein 1
      • Osteocalcin (bovine)
      • Osteocalcin (human)
      • Osteocalcin (mouse)
      • Osteocalcin (pig)
      • Osteocalcin (rat)
      • Osteocalcin carboxylated Gla-OC
      • Osteocalcin undercarboxylated Glu-OC
      • Osteonectin
      • Procollagen type I C-peptide
      • Tartrate-resistant acid phosphatase (TRACP)
    • Cell adhesion and ECM
      • Cadherin
      • Calpastatin
      • Fibronectin
      • Heparan degrading enzyme
      • Laminin
      • Vitronectin
      • von Willebrand factor
    • Epigenetic antibodies
      • Histone
    • Metabolic diseases
      • Glucagon
      • Insulin
    • Signal transduction
      • Albumin
      • GMP-140
      • Universal tyrosine kinase
    • Stem cell research antibodies
      • Hepatic cell differentiation antibodies
      • Neural progenitor cell antibodies
      • STEM antibodies
    • Virus research
      • Influenza
    • Miscellaneous research areas
      • Primary antibodies A-K
        • Ago2
      • Primary antibodies L-Z
        • Protein S
        • Trigger Factor
  • Secondary antibodies
    • Unconjugated IgG and IgY
    • Secondary antibody alternative
  • Antibody and ELISA accessories
    • IgG
    • M300 streptavidin magnetic microparticles
    • Wash and Stop Solution for ELISA
    • Peptide Coating Kit for ELISA plates
  • Fluorescent protein antibodies
    • Green fluorescent protein antibodies
    • Red fluorescent protein antibodies
    • Orange fluorescent protein antibodies
    • Yellow fluorescent protein antibodies
    • Cyan fluorescent protein antibodies
    • Far red fluorescent protein antibodies
Need help?
Contact Sales

Antibodies and ELISA kits

Find the right antibodies and ELISA kits for your research

We offer a wide range of primary antibodies and ELISA kits. Choose your research area to be taken to the tools that match your focus.

Product information:

  • Ago2
  • Bone specific alkaline phosphatase
  • Calpastatin
  • Dentin matrix protein 1
  • Glucagon
  • Heparan degrading enzyme
  • Histone
  • Insulin
  • Neural progenitor cell antibodies
  • Osteocalcin (human)
  • Osteocalcin (pig)
  • Osteocalcin carboxylated Gla-OC
  • Osteonectin
  • Protein S
  • Tartrate-resistant acid phosphatase (TRACP)
  • Universal tyrosine kinase
  • von Willebrand factor
  • Albumin
  • Cadherin
  • Collagen type 2
  • Fibronectin
  • GMP-140
  • Hepatic cell differentiation antibodies
  • Influenza
  • Laminin
  • Osteocalcin (bovine)
  • Osteocalcin (mouse)
  • Osteocalcin (rat)
  • Osteocalcin undercarboxylated Glu-OC
  • Procollagen type I C-peptide
  • STEM antibodies
  • Trigger Factor
  • Vitronectin
Cat. # Product Size License Quantity Details
MA309B Anti-Acetyl Histone H3 (Lys27), mouse monoclonal antibody 100 uL USD $469.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA305B Anti-Acetyl Histone H3 (Lys9), mouse monoclonal antibody 100 uL USD $469.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA310B Anti-Acetyl Histone H3 (Lys9/27), mouse monoclonal antibody 100 uL USD $461.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA332B Anti-Dimethyl Histone H3 (Lys36), Mouse Monoclonal Antibody 100 uL USD $452.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA303B Anti-dimethyl Histone H3 (Lys4), mouse monoclonal antibody 100 uL USD $461.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA307B Anti-Dimethyl Histone H3 (Lys9), mouse monoclonal antibody 100 uL USD $452.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA301B Anti-Histone H3 (mouse), Monoclonal 100 uL USD $452.00

An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. Histone H3 antibodies were generated via a 13-amino acid peptide on N-terminal human histone H3.1. 

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
M211 Anti-Human Ago2, Monoclonal (Clone 1B1) 0.2 mg USD $423.00

Monoclonal antibody generated against the N-terminal region of human recombinant protein Ago2, a member of the Argonaute family. The Ago2 protein is a transcription factor that is required for RNA-mediated gene silencing (RNAi). Argonaute proteins bind small interfering RNA (siRNA) fragments and have endonuclease activity against mRNA that is complementary to the bound siRNA fragment.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
M231 Anti-Human Crx, Polyclonal 0.2 mg USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against two peptide fragments of Human Crx (Cone-rod homeobox protein; a transcription factor that is specifically expressed in photoreceptors and pinealocytes and is important for development and functional homeostasis of cone cells and rod cells forming the retinal cells) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of peptide sequences from several Crx homologs

Alignment of peptide sequences from several Crx homologs
Alignment of peptide sequences from several Crx homologs.
M232 Anti-Human Insulin C, Monoclonal (Clone h-Ins 1B-1) 0.1 mg USD $457.00

Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells of C57BL/6 mouse after immunization with KLH-conjugated peptide from human insulin C-peptide sequence (71–86) [GPGAGSLQPLALEGSL]. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
M227 Anti-Human/Mouse Bf1, Polyclonal 0.2 mg USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide of human/mouse Brain factor 1 (Transcription Factor BF-1/forkhead box protein G1/FOXG1B) [SLPSF TTGLS GGLSD YFTHQ NQGSS SNPLI H] conjugated with bovine thyroglobulin. Brain factor 1 is a transcription factor that is localized in the neural progenitor cells for the cerebrum. It is responsible for the development of the telencephalon.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of the C-terminal amino acid sequences of several Bf1 homologs

Alignment of the C-terminal amino acid sequences of several Bf1 homologs
Alignment of the C-terminal amino acid sequences of several Bf1 homologs.

Back

Immunohistochemical Staining with Anti-Human/Mouse Bf1, Polyclonal (Cat

Immunohistochemical Staining with Anti-Human/Mouse Bf1, Polyclonal (Cat
Immunohistochemical Staining with Anti-Human/Mouse Bf1, Polyclonal (Cat. No. M227) and DAPI. Tissue: Embryonic mouse, day 11 (E11). Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blue, DAPI stain; red, anti-Bf1 antibody.
M229 Anti-Human/Mouse Rx, Polyclonal (Guinea Pig) 0.2 mg USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a guinea pig polyclonal antibody raised against three peptide fragments of Rx (Retinal homeobox protein; a homeobox transcription factor that functions in eye development and is expressed early in the eye primordi,) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of peptide sequences from several Rx homologs

Alignment of peptide sequences from several Rx homologs
Alignment of peptide sequences from several Rx homologs.

Back

Immunohistochemical Staining with Anti-Human/Mouse Rx, Polyclonal (Guinea Pig) (Cat

Immunohistochemical Staining with Anti-Human/Mouse Rx, Polyclonal (Guinea Pig) (Cat
Immunohistochemical Staining with Anti-Human/Mouse Rx, Polyclonal (Guinea Pig) (Cat. No. M229) and DAPI. Tissue: Mouse head, sagittal section. Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blue, DAPI stain; red, anti-Rx antibody.
MA321B Anti-Monomethyl Histone H3 (Lys27), Mouse Monoclonal Antibody 100 uL USD $452.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA331B Anti-Monomethyl Histone H3 (Lys36), Mouse Monoclonal Antibody 100 uL USD $452.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA302B Anti-Monomethyl Histone H3 (Lys4), mouse monoclonal antibody 100 uL USD $461.00

An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. Histone H3 antibodies were generated via a 13-amino acid peptide on N-terminal human histone H3.1. 

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA306B Anti-Monomethyl Histone H3 (Lys9), mouse monoclonal antibody 100 uL USD $461.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
M234 Anti-Mouse Albumin, Monoclonal (Clone M-Alb 151-1) 0.1 mg USD $399.00

Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with lymph cells from an SD rat after immunization with purified albumin from mouse plasma. The monoclonal antibody was harvested from the clone's culture supernatant in serum free medium.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M234: Anti-Mouse Albumin, Monoclonal (Clone M-Alb 151-1)

M234: Anti-Mouse Albumin, Monoclonal (Clone M-Alb 151-1)
M233 Anti-Mouse Insulin C, Monoclonal (Clone M-Ins 1J-4) 0.1 mg USD $457.00

Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells of SD rat after immunization with KLH-conjugated peptide from mouse insulin C-peptide sequence (71–84) [SPGDLQTLALEVAR]. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M233: Anti-Mouse Insulin C, Monoclonal (Clone M-Ins 1J-4)

M233: Anti-Mouse Insulin C, Monoclonal (Clone M-Ins 1J-4)
M178 Anti-Mouse Insulin C, Polyclonal 0.1 mg USD $457.00

This antibody is suitable for studies on the structure, function, and metabolism of insulin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Amino acid alignment of insulin from various mammals

Amino acid alignment of insulin from various mammals
Amino acid alignment of insulin from various mammals. The C-peptide region is boxed (amino acides 57-88), and the peptide used to produce this antibody (Cat. # M178) is highlighted in blue.
M230 Anti-Mouse Irx3, Polyclonal 0.2 mg USD $495.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide of mouse Irx3 (Iroquois related homeobox 3) [CSALE VEKKL LKTAF QPVPR RPQNH LDAAL VLSAL SSS] conjugated with KLH. Irx 3 is a transcription factor that is localized in the caudal nerve and expressed in the neural plate during the early development of the central nervous system.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of the C-terminal amino acid sequences of several Irx3 homologs

Alignment of the C-terminal amino acid sequences of several Irx3 homologs
Alignment of the C-terminal amino acid sequences of several Irx3 homologs.

Back

Immunohistochemical Staining with Anti-Mouse Irx3, Polyclonal (Cat

Immunohistochemical Staining with Anti-Mouse Irx3, Polyclonal (Cat
Immunohistochemical Staining with Anti-Mouse Irx3, Polyclonal (Cat. No. M230) and DAPI. Tissue: Embryonic mouse, day 10 (E10). Fixation: 4% paraformaldehyde, 6 h. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 10% normal Donkey serum in PBS. Blue, DAPI stain; red, anti-Irx3 antibody.
M228 Anti-Mouse Rx, Polyclonal 0.2 mg USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against three peptide fragments of Rx (Retinal homeobox protein; a homeobox transcription factor that functions in eye development and is expressed early in the eye primordi,) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Immunohistochemical Staining with Anti-Mouse Rx, Polyclonal (Cat

Immunohistochemical Staining with Anti-Mouse Rx, Polyclonal (Cat
Immunohistochemical Staining with Anti-Mouse Rx, Polyclonal (Cat. No. M228) and DAPI. Tissue: Mouse head, sagittal section. Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blue, DAPI stain; red, anti-Rx antibody.

Back

Alignment of peptide sequences from several Rx homologs

Alignment of peptide sequences from several Rx homologs
Alignment of peptide sequences from several Rx homologs.
MA251B Anti-Phospho Histone H2B (Ser14), Mouse Monoclonal Antibody 100 uL USD $452.00

An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. The Anti-Phospho Histone H2B (Ser14) antibody (MA251B) was generated via a 19-amino acid peptide surrounding Ser14 on human histone H2B.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA312B Anti-Phospho Histone H3 (Ser10), mouse monoclonal antibody 100 uL USD $461.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
M235 Anti-Rat Albumin, Monoclonal (Clone R-Alb 214A-1) 0.1 mg USD $399.00

Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a  C57BL/6 mouse after immunization with purified albumin from rat plasma. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M235: Anti-Rat Albumin, Monoclonal (Clone R-Alb 214A-1)

M235: Anti-Rat Albumin, Monoclonal (Clone R-Alb 214A-1)
MA323B Anti-Trimethyl Histone H3 (Lys27), Mouse Monoclonal Antibody 100 uL USD $452.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA333B Anti-Trimethyl Histone H3 (Lys36), Mouse Monoclonal Antibody 100 uL USD $452.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA304B Anti-Trimethyl Histone H3 (Lys4), mouse monoclonal antibody 100 uL USD $452.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
MA308B Anti-Trimethyl Histone H3 (Lys9), mouse monoclonal antibody 100 uL USD $452.00

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents
M190 Bone Specific Alkaline Phosphatase (Rat), Polyclonal 0.1 mg USD $522.00

This product was raised against conjugate of KLH and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] that illustrates an exceptional homology with human and rat Bone Specific Alkaline Phosphatase.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
M193 Collagen type 2 Clone 20G-12E (Rat), Monoclonal 0.1 mg USD $457.00

Monoclonal antibody was produced from an established hybridoma obtained by fusing the mouse myeloma cell line P3U1 with lympho cells from a C57BL/6 mouse after immunization with rat collagen type II. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
MK115 Fibronectin EIA Kit 96 Assays USD $726.00

The human Fibronectin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for the specific quantitative determination of human fibronectin in serum, urine, cell culture supernatants, and other biological fluids. This kit is suitable for quantitation of soluble human fibronectin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Application Example: Fibronectin Levels in Cell Culture Supernatants The amount of Fibronectin in the supernatant of various cells cultured in 10% FCS/RPMI 1640 or serum free/Ultradoma PF was measured

Application Example: Fibronectin Levels in Cell Culture Supernatants The amount of Fibronectin in the supernatant of various cells cultured in 10% FCS/RPMI 1640 or serum free/Ultradoma PF was measured
Application Example: Fibronectin Levels in Cell Culture Supernatants

The amount of Fibronectin in the supernatant of various cells cultured in 10% FCS/RPMI 1640 or serum free/Ultradoma PF was measured. The supernatant was applied to the assay without dilution. Fetal calf serum does not inhibit this assay system.

+S: 10% FCS/RPMI 1640
SF: serum free medium (2 days after the change from the medium containing serum)

.

Back

MK115: Fibronectin EIA Kit

MK115: Fibronectin EIA Kit
MK147 Gla/Glu Osteocalcin High Sensitive EIA Set (Rat) Each USD $1245.00

Gla/Glu Osteocalcin High Sensitive EIA Set (Rat; Cat. # MK147) is a combination of Rat Gla-Osteocalcin High Sensitive EIA Kit (Cat.# MK126) and Rat Glu-Osteocalcin High Sensitive EIA Kit (Cat.# MK146). Since both kits have the same capture antibody, they can be used together for simultaneous Gla/Glu detection, thereby making simultaneous monitoring of bone formation and resorption possible.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

MK111 Gla-Type Osteocalcin (Gla-OC) EIA Kit 96 Assays USD $849.00

The Gla-type Osteocalcin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for quantitative determination of human Gla-OC in serum, cultured cell extracts, cell culture supernatants, and other biological fluids.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK111: Gla-Type Osteocalcin (Gla-OC) EIA Kit

MK111: Gla-Type Osteocalcin (Gla-OC) EIA Kit
MK412 Heparan Degrading Enzyme Assay Kit 96 Assays USD $756.00

Takara's Heparan Degrading Enzyme Assay Kit provides a 96-well non-radioactive assay for the measurement of heparan degrading enzyme activity in cultured cells, tissues, or serum as well as screening of heparan sulfate degrading enzyme inhibitors. This kit is based upon the property of heparin-like molecules to bind bFGF (basic fibroblast growth factor). When heparan sulfate is degraded by heparan sulfate degrading enzyme, it loses its ability to bind to bFGF. Thus, the enzymic activity of a sample can be quantitated by comparing the amount of bFGF-bound undegraded heparan sulfate of the sample to total-bound heparan sulfate of a heparanase-free control. A unique feature of this kit is the use of CBD-FGF, a fusion protein composed of human fibronectin cell-binding domain and human fibroblast growth factor. CBD-FGF is immobilized on the surface of Takara's microtiter plate by an anti-fibronectin antibody containing an epitope in the CBD region. Termed DOC (Domain Oriented Capture), this solid phase attachment method allows a natural 3-dimensional bFGF structure for enhanced accessibility and binding to heparan sulfate. Detection is by a colorimetric method using biotinylated heparan sulfate as the substrate.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Resources
MK132 Human Albumin EIA Kit 96 Rxns USD $726.00

This quantification kit using a human albumin-specific monoclonal antibody can be utilized as a simple tool to monitor albumin levels in human serum and body fluids, among other purposes.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
MK128 Human Gla-Osteocalcin High Sensitive EIA Kit 96 Rxns USD $1064.00

This kit is designed to precisely differentiate bovine and human osteocalcins, using a capture antibody-coated plate with a human osteocalcin-specific monoclonal antibody that recognizes the distinct difference in the amino acids at positions 3 and 4 from the N-terminus. This makes possible differential assays of human and bovine osteocalcins. Use of human antigen-specific antibody as a capture monoclonal antibody provides improved linearity when assaying human blood samples. This specificity also enables direct assay of human osteocalcin in the culture supernatant of osteoblasts or differentiated osteoblasts from bone marrow or mesenchymal stem cells cultured in a bovine serum-containing medium, which has been difficult to achieve using the conventional Gla-OC EIA Kit (Cat. #MK111).

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK128: Human Gla-Osteocalcin High Sensitive EIA Kit

MK128: Human Gla-Osteocalcin High Sensitive EIA Kit
MK103 Human Vitronectin EIA Kit 96-Well USD $726.00

The Human Vitronectin EIA Kit can detect two types of VN protein (65 and 75 kD) in blood using monoclonal antibodies. It can be also used for VN detection in urine and cell culture supernatant. In addition, this kit can also detect vitronectin in rabbit. Because the antibody in this kit does not cross-react with bovine vitronectin antigens, cell culture medium containing fetal bovine serum can be measured directly.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK103: Human Vitronectin EIA Kit

MK103: Human Vitronectin EIA Kit
MK114 Human/Pig Osteonectin EIA Kit 96-Well USD $726.00

This kit is a sandwich-type osteonectin EIA assay based on two monoclonal antibodies, which are derived from bovine and human osteonectin antigens. It enables simple quantification of human, pig, bovine, and rabbit osteonectin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK114: Human/Pig Osteonectin EIA Kit

MK114: Human/Pig Osteonectin EIA Kit
MK107 Laminin EIA Kit 96 Rxns USD $739.00

The Laminin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for quantitative determination of human LN in plasma, serum, urine, cultured cell extracts, cell culture supernatants, and other biological fluids.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK107: Laminin EIA Kit

MK107: Laminin EIA Kit
M226 Monoclonal Antibody to Human Albumin 0.1 mg USD $399.00

Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a BALB/c mouse after immunization with purified human albumin from human plasma.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M226: Anti-Human Albumin, Monoclonal (Clone hAlb3-7A)

M226: Anti-Human Albumin, Monoclonal (Clone hAlb3-7A)
M225 Monoclonal Antibody to Human Alpha Fetoprotein 0.1 mg USD $399.00

Antibody for detection of alpha-fetoprotein (AFP): Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of BALB/c mouse after immunization with purified human alpha fetoprotein from human plasma.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M225: Anti-Human Alpha Fetoprotein, Monoclonal

M225: Anti-Human Alpha Fetoprotein, Monoclonal
M201 Monoclonal Antibody to TF (Trigger Factor) 0.1 mg USD $411.00

Monoclonal antibody to Trigger Factor (TF) molecular chaperone; can be used for western blotting or immunoprecipitation of TF-tagged recombinant proteins. This antibody was obtained by fusing the P3U1 myeloma cell line with lymph node cells from a  C57BL/6 mouse after immunization with synthetic peptide (165–178)[ TIDFTGSVDGEEFE] of Trigger Factor (a chaperon protein derived from E. coli) conjugated with KLH. The monoclonal antibody was harvested from ascitic fluid from a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M201: Monoclonal Antibody to TF (Trigger Factor)

M201: Monoclonal Antibody to TF (Trigger Factor)
M041 Monoclonal Anti-Bovine Osteocalcin (Clone OC4-30) 0.1 mg USD $457.00

This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins. Clone OC4-30 is specific for γ-carboxylated osteocalcin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Recognition Sites of Anti-Osteocalcin Monoclonal Antibodies Assayed by Peptide Fragments

Recognition Sites of Anti-Osteocalcin Monoclonal Antibodies Assayed by Peptide Fragments
Recognition Sites of Anti-Osteocalcin Monoclonal Antibodies Assayed by Peptide Fragments.

Back

M041: Monoclonal Anti-Bovine Osteocalcin (Clone OC4-30)

M041: Monoclonal Anti-Bovine Osteocalcin (Clone OC4-30)
M042 Monoclonal Anti-Bovine Osteocalcin (Clone OCG2) 0.1 mg USD $457.00

This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M042: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG2)

M042: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG2)
M043 Monoclonal Anti-Bovine Osteocalcin (Clone OCG3) 0.1 mg USD $457.00

This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M043: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG3)

M043: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG3)
M044 Monoclonal Anti-Bovine Osteocalcin (Clone OCG4) 0.1 mg USD $457.00

This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M044: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG4)

M044: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG4)
M110 Monoclonal Anti-chicken N-Cadherin (Clone NCD-2) 0.1 mg USD $409.00

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. NCD-2 was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M110: Monoclonal Anti-chicken N-Cadherin (Clone NCD-2)

M110: Monoclonal Anti-chicken N-Cadherin (Clone NCD-2)
M045 Monoclonal Anti-Human Calpastatin (Clone CSL1-5) 0.1 mg USD $457.00

This monoclonal anti-human calpastatin antibody (CSL1-5 clone) was raised against recombinant muscle-type calpastatin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Recognition Sites of the Anti-Human Calpastatin Antibodies

Recognition Sites of the Anti-Human Calpastatin Antibodies
Recognition Sites of the Anti-Human Calpastatin Antibodies.
M106 Monoclonal Anti-Human E-cadherin (Clone HECD-1) 0.1 mg USD $409.00

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. HECD-1 was purified from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

The amino-terminal extracellular portion of the molecule contains sequences that determine the specificity of each cadherin

The amino-terminal extracellular portion of the molecule contains sequences that determine the specificity of each cadherin
The amino-terminal extracellular portion of the molecule contains sequences that determine the specificity of each cadherin. Calcium is required for cadherin-mediated adhesion and also protects cadherins against proteolysis. Clone ECCD-1, PCD-1, and NCD-2 recognize residues around Glu 16 of murine E-cadherin, Gly(31) of murine P-cadherin, and ser(31) of chick N-cadherin, respectively.

Back

Disruption of tumor cell-cell adhesion by anti-E-cadherin MAbs

Disruption of tumor cell-cell adhesion by anti-E-cadherin MAbs

Disruption of tumor cell-cell adhesion by anti-E-cadherin MAbs.

.

Back

M106: Monoclonal Anti-Human E-cadherin (Clone HECD-1)

M106: Monoclonal Anti-Human E-cadherin (Clone HECD-1)
M126 Monoclonal Anti-Human E-cadherin (Clone SHE78-7) 0.1 mg USD $409.00

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. SHE78-7 was purified from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M126: Anti-Human E-cadherin, Monoclonal (Clone SHE78-7)

M126: Anti-Human E-cadherin, Monoclonal (Clone SHE78-7)
M002 Monoclonal Anti-Human Fibronectin (Clone FN12-8) 0.4 mg USD $423.00

These clones were raised against purified human plasma fibronectin. Each recognizes discrete epitopes of fibronectin. For antibody Western blots or histology, clone FN30-8 works best and is also effective for adhesion blockade studies. Clones FN12-8 and FNH3-8 are unique in that they can be used for studies related to fibrin and heparin interactions, respectively.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer tissue (bottom) and moderately-differentiated colon cancer (top)

Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer  tissue (bottom) and moderately-differentiated colon cancer  (top)
Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer tissue (bottom) and moderately-differentiated colon cancer (top). Tissues were stained with monoclonal anti-FN antibodies. Antibody used for each panel: left, clone FN8-12 (discontinued); center, clone FN12-8 (Cat. # M002); right, rabbit polyclonal anti-human FN antibody. Strong staining was observed in cancer tissue samples using the monoclonal FN antibodies.

Back

M002: Anti-Human Fibronectin, Monoclonal (Clone FN12-8)

M002: Anti-Human Fibronectin, Monoclonal (Clone FN12-8)
M010 Monoclonal Anti-Human Fibronectin (Clone FN30-8) 0.4 mg USD $423.00

These clones were raised against purified human plasma fibronectin. Each recognizes discrete epitopes of fibronectin. For antibody Western blots or histology, clone FN30-8 works best and is also effective for adhesion blockade studies. Clones FN12-8 and FNH3-8 are unique in that they can be used for studies related to fibrin and heparin interactions, respectively.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer tissue (bottom) and moderately-differentiated colon cancer (top)

Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer  tissue (bottom) and moderately-differentiated colon cancer  (top)
Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer tissue (bottom) and moderately-differentiated colon cancer (top). Tissues were stained with monoclonal anti-FN antibodies. Antibody used for each panel: left, clone FN8-12 (discontinued); center, clone FN12-8 (Cat. # M002); right, rabbit polyclonal anti-human FN antibody. Strong staining was observed in cancer tissue samples using the monoclonal FN antibodies.

Back

M010: Anti-Human Fibronectin, Monoclonal (Clone FN30-8)

M010: Anti-Human Fibronectin, Monoclonal (Clone FN30-8)
M146 Monoclonal Anti-Human Influenza A (H3N2) (Clone F49) 0.1 mg USD $399.00

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M146: Monoclonal Anti-Human Influenza A (H3N2) (Clone F49)

M146: Monoclonal Anti-Human Influenza A (H3N2) (Clone F49)
M148 Monoclonal Anti-Human Influenza B (Clone 9D6) 0.1 mg USD $399.00

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M148: Monoclonal Anti-Human Influenza B (Clone 9D6)

M148: Monoclonal Anti-Human Influenza B (Clone 9D6)
M020 Monoclonal Anti-Human Laminin (Clone LN82-13) 0.1 mg USD $457.00

This antibody is designed to detect laminin using western blotting analysis under non-reducing and non-heating conditions and for histology on frozen tissue sections and paraffin embedded tissue sections.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data Resources

Back

M020: Anti-Human Laminin, Monoclonal (Clone LN82-13)

M020: Anti-Human Laminin, Monoclonal (Clone LN82-13)
M184 Monoclonal Anti-Human Osteocalcin (Clone 5-12H) 0.1 mg USD $457.00

This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of C57BL6 mouse after immunization with KLH-conjugated peptide from human osteocalcin sequence (amino acids 1-6 YLYQWL). The monoclonal antibody was harvested from scid mouse ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M184: Anti-Human Osteocalcin, Monoclonal (Clone 5-12H)

M184: Anti-Human Osteocalcin, Monoclonal (Clone 5-12H)
M127 Monoclonal Anti-Human P-cadherin (Clone NCC-CAD-299) 0.1 mg USD $409.00

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. NCC-CAD-299 was purified from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M127: Anti-Human P-cadherin, Monoclonal (Clone NCC-CAD-299)

M127: Anti-Human P-cadherin, Monoclonal (Clone NCC-CAD-299)
M063 Monoclonal Anti-Human Platelet GMP-140 (P-selectin/CD62) (Clone PL7-6) 0.1 mg USD $545.00

This clone was raised against activated human platelet GMP-140.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents You May Also Like Image Data Resources

Back

M063: Anti-Human Platelet GMP-140 (CD62), Monoclonal (Clone PL7-6)

M063: Anti-Human Platelet GMP-140 (CD62), Monoclonal (Clone PL7-6)
M062 Monoclonal Anti-Human Platelet GMP-140 (P-selectin/CD62) (Clone WGA-1) 0.1 mg USD $545.00

This clone was raised against activated human platelet GMP-140.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents You May Also Like Image Data Resources

Back

M062: Anti-Human Platelet GMP-140 (CD62), Monoclonal (Clone WGA-1)

M062: Anti-Human Platelet GMP-140 (CD62), Monoclonal (Clone WGA-1)
M011 Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC5-5) 0.1 mg USD $433.00

Collagens (types I, II, III, IV and V) are synthesized as precursor molecules called procollagens. These contain propeptide sequences, at both the amino-terminal and the carboxy-terminal ends. The function of these propeptides is to facilitate the winding of procollagen molecules into a triple-helical conformation within the endoplasmic reticulum. The propeptides are cleaved off from the collagen triple helix molecule during its secretion. The triple helix collagens then polymerize into extracellular collagen fibrils.

Clones PC5-5 and PC8-7 recognize procollagen type I C-peptide. They are suitable for the detection of non-denatured antigen released in tissue culture media and for monitoring of collagen synthesis.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data Resources

Back

M011: Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC5-5)

M011: Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC5-5)
M012 Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC8-7) 0.1 mg USD $423.00

Collagens (types I, II, III, IV and V) are synthesized as precursor molecules called procollagens. These contain propeptide sequences, at both the amino-terminal and the carboxy-terminal ends. The function of these propeptides is to facilitate the winding of procollagen molecules into a triple-helical conformation within the endoplasmic reticulum. The propeptides are cleaved off from the collagen triple helix molecule
during its secretion. The triple helix collagens then polymerize into extracellular collagen fibrils.

Clones PC5-5 and PC8-7 recognize procollagen type I C-peptide. They are suitable for the detection of non-denatured antigen released in tissue culture media and for monitoring of collagen synthesis.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M012: Anti-Human Procollagen Type I C-peptide (PIP), Monoclonal (Clone PC8-7)

M012: Anti-Human Procollagen Type I C-peptide (PIP), Monoclonal (Clone PC8-7)
M171 Monoclonal Anti-Human Undercarboxylated Osteocalcin (Clone GluOC4-5) 0.1 mg USD $457.00

This clone was raised against human osteocalcin peptide. It specifically recognizes human osteocalcin with decarboxylated glutamic acid residues, and does not recognize Gla-type osteocalcin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M171: Anti-Human Undercarboxylated Osteocalcin, Monoclonal (Clone GluOC4-5)

M171: Anti-Human Undercarboxylated Osteocalcin, Monoclonal (Clone GluOC4-5)
M017 Monoclonal Anti-Human Vitronectin (Clone VN58-1) 0.2 mg USD $423.00

This monoclonal antibody was raised against purified human vitronectin. It may be used for Western blots or histology on frozen sections or paraffin embedded tissue. Clone VN58-1 does not interfere with the cell-binding activity of vitronectin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

M017: Anti-Human Vitronectin, Monoclonal (Clone VN58-1)

M017: Anti-Human Vitronectin, Monoclonal (Clone VN58-1)
M029 Monoclonal Anti-Human von Willebrand Factor (vWF) (Clone VW92-3) 0.2 mg USD $423.00

Clone VW92-3 was obtained using a V8 Protease III fragment of human plasma von Willebrand factor as immunogen. This antibody specifically recognizes human von Willebrand factor and does not cross react with bovine von Willebrand factor.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M029: Anti-Human von Willebrand Factor (vWF), Monoclonal (Clone VW92-3)

M029: Anti-Human von Willebrand Factor (vWF), Monoclonal (Clone VW92-3)
M147 Monoclonal Anti-Influenza A (H1, H2, H3) (Clone C111) 0.1 mg USD $401.00

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M147: Monoclonal Anti-Influenza A (H1, H2, H3) (Clone C111)

M147: Monoclonal Anti-Influenza A (H1, H2, H3) (Clone C111)
M107 Monoclonal Anti-mouse E-cadherin (Clone ECCD-1) 0.1 mg USD $409.00

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. ECCD-1 was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M107: Monoclonal Anti-mouse E-cadherin (Clone ECCD-1)

M107: Monoclonal Anti-mouse E-cadherin (Clone ECCD-1)
M108 Monoclonal Anti-mouse E-cadherin (Clone ECCD-2) 0.1 mg USD $417.00

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. ECCD-2 was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M108: Monoclonal Anti-mouse E-cadherin (Clone ECCD-2)

M108: Monoclonal Anti-mouse E-cadherin (Clone ECCD-2)
M188 Monoclonal Anti-Mouse Osteocalcin (Clone R21C-01A) 0.1 mg USD $457.00

Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of SD rat after immunization with KLH-conjugated peptide from mouse osteocalcin sequence (amino acids 25–46 CDELSDQYGLKTAYKRIYGITI). The monoclonal antibody was harvested from ascites fluid of scid mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M188: Monoclonal Anti-Mouse Osteocalcin (Clone R21C-01A)

M188: Monoclonal Anti-Mouse Osteocalcin (Clone R21C-01A)
M109 Monoclonal Anti-mouse P-cadherin (Clone PCD-1 ) 0.1 mg USD $409.00

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. PCD-1 was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M109: Monoclonal Anti-mouse P-cadherin (Clone PCD-1 )

M109: Monoclonal Anti-mouse P-cadherin (Clone PCD-1 )
M125 Monoclonal Anti-Osteonectin/SPARC (Clone ON1-1) 0.1 mg USD $457.00

This clone was raised against bone-derived bovine osteonectin (ON1-1) and human platelet derived osteonectin (OSN4-2). It reacts with thrombin-stimulated platelets, not with non-stimulated platelets.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Immunohistochemical detection of Osteonectin/SPARC in miniature pig tissue

Immunohistochemical detection of Osteonectin/SPARC in miniature pig tissue

Immunohistochemical detection of Osteonectin/SPARC in miniature pig tissue. A section of paraffin-embedded miniature pig joint tissue was stained with an anti-Osteonectin/SPARC monoclonal antibody (Cat. # M125). Takara POD Conjugate Anti Mouse, For Tissue (Cat. # MK204) was used in place of a traditional secondary antibody, and Takara DAB Substrate (Cat. # MK210) was used for detection. The image shown is 100X magnification.

Back

M125: Anti-Osteonectin/SPARC, Monoclonal (Clone ON1-1)

M125: Anti-Osteonectin/SPARC, Monoclonal (Clone ON1-1)
M124 Monoclonal Anti-Osteonectin/SPARC (Clone OSN4-2) 0.1 mg USD $457.00

This clone was raised against bone-derived bovine osteonectin (ON1-1) and human platelet derived osteonectin (OSN4-2). It reacts with thrombin-stimulated platelets, not with non-stimulated platelets.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Resources
M200 Monoclonal Anti-Pro S2, (Clone ProS 7B-8F) 0.1 mg USD $545.00

Anti-Protein S is a monoclonal antibody used for detection of ProS2-fused protein expressed by using pCold ProS2 DNA. ProS2 is about 23 kDa of a solubilization tag which is a tandem-dimer of the N-terminal domain of Protein S, a soluble protein derived from myxobacteria Myxococcus xanthus.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M200: Anti-ProS2, Monoclonal

M200: Anti-ProS2, Monoclonal
M192 Monoclonal Anti-Rat Collagen type II (Clone Col II 2B-11F) 0.1 mg USD $457.00

Monoclonal antibody was produced from an established hybridoma obtained by fusing the mouse myeloma cell line P3U1 with lympho cells from a C57BL/6 mouse after immunization with rat collagen type II. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
M186 Monoclonal Anti-Rat Osteocalcin (Clone 6-7H) 0.1 mg USD $457.00

This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjugated peptide from rat osteocalcin (amino acids 1–25: YLNNGLGAPAPYPDPLEPHREVCEL). The monoclonal antibody was harvested from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M186: Anti-Rat Osteocalcin, Monoclonal (Clone 6-7H)

M186: Anti-Rat Osteocalcin, Monoclonal (Clone 6-7H)
M187 Monoclonal Anti-Rat Osteocalcin (Clone 9-12H) 0.1 mg USD $457.00

License Statement

ID Number  
M76 This product is covered by the claims of Japanese Patent No. 5280916.

This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjuagated peptide from rat osteocalcin (amino acids 38–50: FQDAYKRIYGTTV). The monoclonal antibody was harvested from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
M185 Monoclonal Anti-Rat Osteocalcin (Clone D-8G) 0.1 mg USD $457.00

This monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjugated peptide from rat osteocalcin (amino acids 1–25: YLNNGLGAPAPYPDPLEPHREVCEL). The monoclonal antibody was harvested from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M185: Anti-Rat Osteocalcin, Monoclonal (Clone D-8G)

M185: Anti-Rat Osteocalcin, Monoclonal (Clone D-8G)
MK133 Mouse Albumin EIA Kit 96-Well USD $726.00

This product is a sandwich-type mouse albumin assay kit that uses two rat monoclonal antibodies generated against mouse albumin. The kit makes it possible to easily measure mouse albumin in vitro and in vivo. Since the assay is performed using monoclonal antibodies, it provides excellent specificity because these antibodies do not cross-react with albumin from other species.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK133: Mouse Albumin EIA Kit

MK133: Mouse Albumin EIA Kit
MK127 Mouse Gla-Osteocalcin High Sensitive EIA Kit 96 Rxns USD $817.00

The Mouse Gla-Osteocalcin High Sensitive EIA Kit is an quantitative kit that enables specific and highly sensitive assay of mouse Gla-osteocalcin that exhibits a potential to osseointegration (active osteocalcin). The capture antibody (plate-bound antibody) is a plate-bound solid-phased rat monoclonal antibody that specifically recognizes the C-terminal region of mouse osteocalcin. It is paired with labeled antibody-a monoclonal antibody for detecting osteocalcin with Gla residues. Because mouse osteocalcin has C terminal region sequences that differ from those in humans, cattle and other large animals, it is possible to measure mouse osteocalcin without any cross-reaction with bovine antigens through capture of the antigen with antibodies recognizing a C-terminal epitope. Therefore, one can monitor the process of osteoblastic cell differentiation from pluripotent cells such as mouse ES and iPS cells without interference from bovine serum included in the culture medium.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK127: Mouse Gla-Osteocalcin High Sensitive EIA Kit

MK127: Mouse Gla-Osteocalcin High Sensitive EIA Kit
MK129 Mouse Glu-Osteocalcin High Sensitive EIA Kit 96 Rxns USD $1064.00

The Mouse Glu-Osteocalcin High Sensitive EIA Kit is an quantitative kit that enables specific and highly sensitive assay of decarboxylated osteocalcin from mouse bone tissue by enzymes present in osteoclasts and Glu-type osteocalcin (inactive osteocalcin) that has been produced by osteoblasts but has not undergone carboxylation. Because mouse osteocalcin has C terminal sequences that differ from those in humans, cattle, and other large animals, it is possible to measure mouse osteocalcin without cross-reaction with bovine antigens by using antibodies that recognize C-terminal epitopes. Therefore, it is possible to monitor osteoblastic cell differentiation from pluripotent cells such as mouse ES and iPS cells without interference from bovine serum included in the culture medium. Bone turnover can also be analyzed by simultaneously measuring Gla-type and Glu-type osteocalcin. Gla-type osteocalcin can be evaluated using the Mouse Gla-Osteocalcin High Sensitive EIA Kit (Cat. #MK127), which includes a monoclonal antibody that specifically recognizes the Gla residues of osteocalcin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK129: Mouse Glu-Osteocalcin High Sensitive EIA Kit

MK129: Mouse Glu-Osteocalcin High Sensitive EIA Kit
MK139 Pig Gla-Osteocalcin EIA Kit 96 Rxns USD $778.00

The Pig Gla-Osteocalcin EIA Kit is a quantitative kit that enables specific and highly sensitive assay of porcine Gla-osteocalcin that exhibits a potential to osseointegration (active osteocalcin). The capture antibody (plate-bound antibody) is a plate-bound solid-phased monoclonal antibody that specifically recognizes the Gla residue at position 17 on osteocalcin. It is paired with a labeled antibody—a monoclonal antibody for detecting porcine osteocalcin. The concurrent measurement of undercarboxylated porcine osteocalcin (Glu-osteocalcin) may be achieved with the Pig Glu-Osteocalcin EIA Kit (Cat. #MK149) to monitor both bone formation and bone resorption based on a relative evaluation of Gla/Glu-osteocalcins.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK139: Pig Gla-Osteocalcin EIA Kit

MK139: Pig Gla-Osteocalcin EIA Kit
M149 Polyclonal Antibody to Human Influenza A, B (Rabbit Polyclonal) 0.4 mg USD $318.00

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
M202 Polyclonal Antibody to Human L7/Pcp2 0.2 mg USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide [TALGF RRNSS PQPPT QAP] of human L7/Pcp2 (a marker of the purkinje progenitor cells in brain and nervous system) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
M196 Polyclonal Antibody to Mouse Emx1 100 uL USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a guinea pig polyclonal antibody raised against C-terminal region peptide [ESEQK KKGSH HINRW RIATK QANGE DIDVT SND] of mouse Emx 1 (Empty spiracles homeobox 1; marker of embryonic development in cerebral cortex neurons) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Amino acid alignment of the C-terminal regions of several Emx1 homologs

Amino acid alignment of the C-terminal regions of several Emx1 homologs
Amino acid alignment of the C-terminal regions of several Emx1 homologs.

Back

Immunohistochemical Staining with Polyclonal Antibody to Mouse Emx1 (Cat

Immunohistochemical Staining with Polyclonal Antibody to Mouse Emx1 (Cat
Immunohistochemical Staining with Polyclonal Antibody to Mouse Emx1 (Cat. No. M196). Tissue: Embryonic mouse, 10.5 days (E10.5), sagittal section of telencephalon, dorsal region located at top. Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 2% skim milk in PBS.
M194 Polyclonal Antibody to Mouse L7/Pcp2 100 uL USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. L7/Pcp2 is a rabbit polyclonal antibody raised against C-terminal region peptide [AALSF RRNSS PQPQT QAP] of mouse L7/Pcp2 (a marker of the purkinje progenitor cells in brain and nervous system) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of C-terminal amino acid sequence of mouse, human, bovine, rat, and pig L7/Pcp2 homologs

Alignment of C-terminal amino acid sequence of mouse,  human, bovine, rat, and pig L7/Pcp2 homologs
Alignment of C-terminal amino acid sequence of mouse, human, bovine, rat, and pig L7/Pcp2 homologs.

Back

Immunohistochemical staining with Polyclonal Antibody to Mouse L7/Pcp2Postnatal (Cat

Immunohistochemical staining with Polyclonal Antibody to Mouse L7/Pcp2Postnatal (Cat
Immunohistochemical staining with Polyclonal Antibody to Mouse L7/Pcp2Postnatal (Cat. No. M194). Tissue: 1-day-old mouse cerebellum, sagittal section. Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 2% skim milk in PBS.

Back

Immunohistochemical detection of neural progenitor cells in mouse cerebellum

Immunohistochemical detection of neural progenitor cells in mouse cerebellum

Immunohistochemical detection of neural progenitor cells in mouse cerebellum. A section of formalin-fixed paraffin-embedded mouse cerebellum tissue was stained with an anti-L7/Pcp2 antibody (Cat. # M194). Takara POD Conjugate Anti Rabbit, For Mouse Tissue (Cat. # MK202) was used in place of a traditional secondary antibody, and Takara DAB Substrate (Cat. # MK210) was used for detection. The image shown is 100X magnification.

M195 Polyclonal Antibody to Mouse Otp 100 uL USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. Otp is a guinea pig polyclonal antibody raised against C-terminal region peptide [LRRKA LEHTV SMSFT] of mouse Otp (homeobox protein Orthopedia; a marker of the hindbrain and hypothalamic neurons during embryonic development ) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of the C-terminal amino acid sequences of several homologs of Otp

Alignment of the C-terminal amino acid sequences of several homologs of Otp
Alignment of the C-terminal amino acid sequences of several homologs of Otp.

Back

Immunohistochemical Staining with Polyclonal Antibody to Mouse Otp (Cat

Immunohistochemical Staining with Polyclonal Antibody to Mouse Otp (Cat
Immunohistochemical Staining with Polyclonal Antibody to Mouse Otp (Cat. No. M195) and DAPI. Tissue: Embryonic mouse, 13.5 days (E13.5), hypothalamus, hindbrain, rostral. Fixation: 4% paraformaldehyde, 6 h. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 2% skim milk in PBS. .
M198 Polyclonal Antibody to Mouse Otx2 100 uL USD $489.00

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide [CGSYL TPMHH QLPGP GATLS PMGTN] of mouse Otx2 [Orthdenticle homeobox 2; a marker of the most upstream transcription factor that controls the differentiation of the forebrain and the retinal photoreceptor cells (cone cells and rod cells) in embryonic development] conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Image Data

Back

Immunohistochemical Staining with Polyclonal Antibody to Mouse Otx2 (Cat

Immunohistochemical Staining with Polyclonal Antibody to Mouse Otx2 (Cat
Immunohistochemical Staining with Polyclonal Antibody to Mouse Otx2 (Cat. No. M198) and DAPI. Tissue: Embryonic mouse, day 10 (E10), forebrain to midbrain. Fixation: 4% paraformaldehyde, 6 h. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 2% skim milk in PBS. Blue, DAPI stain; red, anti-Otx2 antibody.

Back

Alignment of the C-terminal amino acid sequences of several Otx2 homologs

Alignment of the C-terminal amino acid sequences of several Otx2 homologs
Alignment of the C-terminal amino acid sequences of several Otx2 homologs.
M176 Polyclonal Anti-Dentin Matrix Protein-I (DMP-1) 0.1 mg USD $495.00

This product is a rabbit polyclonal antibody raised against an N-terminal region of rat Dentin Matrix Protein-1.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Resources
M182 Polyclonal Anti-Glucagon 0.1 mg USD $436.00

This antibody was raised in guinea pig against a peptide of human glucagon conjugated with KLH. It can be used for immunohistochemical detection of glucagon or paraffin-embedded or frozen tissue sections.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components
M173 Polyclonal Anti-Mouse Osteocalcin (Clone mOC(1-20)) 0.1 mg USD $457.00

This product was raised against N-terminal peptide of mouse osteocalcin, and specifically recognizes mouse osteocalcin. It does not cross react with rat osteocalcin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Resources
M142 Polyclonal Anti-N-cadherin 0.4 mg USD $334.00

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. This polyclonal antibody was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M142: Anti-N-cadherin, Polyclonal

M142: Anti-N-cadherin, Polyclonal
MK101 Procollagen Type I C-Peptide (PIP) EIA Kit 96 Assays USD $732.00

The Procollagen Type I C-peptide EIA Kit is an in vitro enzyme immunoassay (EIA) kit for the quantification of human, bovine, canine, horse, or monkey PIP in plasma, serum, cultured cell extracts, cell culture supernatants, or other biological fluids.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data Resources

Back

Typical Procollagen Standard Curve

Typical Procollagen Standard Curve
Typical Procollagen Standard Curve. A standard solution containing 640 ng PIP/mL was used to generate a standard curve. A dilution series was prepared by mixing the standard solution and sample diluent. Standard curves should be generated for each assay.

Back

Measurement of PIP in cultured supernatant of several cell lines (background levels in media will differ between FCS batches)

Measurement of PIP in cultured supernatant of several cell lines (background levels in media will differ between FCS batches)
Measurement of PIP in cultured supernatant of several cell lines (background levels in media will differ between FCS batches). Note: measurement with this kit may be shifted if it is performed with samples which include animal serum such as Fetal Bovine Serum and Horse Serum. It is recommended to perform the measurement under serum-free conditions.

Back

Experimental Example: Stimulation of Collagen Synthesis by TGF-beta

Experimental Example: Stimulation of Collagen Synthesis by TGF-beta
Experimental Example: Stimulation of Collagen Synthesis by TGF-beta. MG63 osteosarcoma cells were cultured in the presence or absence of TGF-beta. PIP levels were measured using Cat.# MK101.

Back

MK101: Procollagen Type I C-Peptide (PIP) EIA Kit

MK101: Procollagen Type I C-Peptide (PIP) EIA Kit
MK126 Rat Gla-Osteocalcin High Sensitive EIA Kit 96 Rxns USD $817.00

Rat Gla-Osteocalcin High Sensitive EIA Kit is a sandwich-type EIA kit which uses a rat osteocalcin C-terminus-specific antibody as capture-antibody on a solid-phase plate. This antibody has a minimal cross reactivity with bovine, human and rabbit osteocalcin. An enzyme-labeled antibody (GlaOC4-30) specific to Gla-OC is used as the detection antibody, allowing this kit to detect Gla-osteocalcin with a very high sensitivity. As such, this EIA kit is sensitive enough to detect even minute levels of rat osteocalcin produced in supernatants of cells cultured in fetal calf serum-supplemented medium.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK126: Rat Gla-Osteocalcin High Sensitive EIA Kit

MK126: Rat Gla-Osteocalcin High Sensitive EIA Kit
MK146 Rat Glu-Osteocalcin High Sensitive EIA Kit 96 Rxns USD $817.00

Rat Glu-Osteocalcin High Sensitive EIA Kit is a sandwich-type EIA kit in which rat osteocalcin C terminal region recognition specific antibody is the capture antibody on a solid plate and a monoclonal antibody that is specific to the Glu residues that straddle positions 21 and 24 of osteocalcin is arranged as the detection antibody. This product makes high-sensitivity measurement of minor antigens and maintenance of stable reproducibility possible. The use of a 96-well plate makes it possible to assay many sample treatments. Moreover, as it has the same capture antibody as the Rat Gla-Osteocalcin High Sensitive EIA Kit (Cat. #MK126), the kits may be used together for simultaneous Gla/Glu detection, thereby making simultaneous monitoring of bone formation and resorption possible.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK146: Rat Glu-Osteocalcin High Sensitive EIA Kit

MK146: Rat Glu-Osteocalcin High Sensitive EIA Kit
Y40400 STEM101™ 50 ug USD $288.00

STEM101 reacts specifically with a protein located in the nucleus of human cells. This antibody detects cells from a variety of human tissues including brain. This antibody does not cross-react with brain tissue or extracts from mouse or rat.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

STEM101 detects nuclei of transplanted human neural stem cells in the olfactory bulb of a mouse brain

STEM101 detects nuclei of transplanted human neural stem cells in the olfactory bulb of a mouse brain
STEM101 detects nuclei of transplanted human neural stem cells in the olfactory bulb of a mouse brain.

Back

Y40400: STEM101

Y40400: STEM101
Y40410 STEM121™ 50 ug USD $288.00

STEM121 reacts specifically with a cytoplasmic protein of human cells. This marker is expressed in cells from a variety of tissues including brain, liver and pancreas. However, it is expressed most highly in central nervous system (CNS) cells. This antibody does not cross-react with brain tissue or extracts from mouse, rat, or cynomologous monkey.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

STEM121 detects migration and differentiation of transplanted human neural stem cells in the hippocampus of a mouse brain

STEM121 detects migration and differentiation of transplanted human neural stem cells in the hippocampus of a mouse brain
STEM121 detects migration and differentiation of transplanted human neural stem cells in the hippocampus of a mouse brain.

Back

STEM121 detects presence of transplanted human liver engrafting cells in a mouse liver

STEM121 detects presence of transplanted human liver engrafting cells in a mouse liver
STEM121 detects presence of transplanted human liver engrafting cells in a mouse liver.

Back

Y40410: STEM121

Y40410: STEM121
Y40420 STEM123™ 50 ug USD $288.00

STEM123 reacts specifically with glial fibrillary acidic protein (GFAP) of human cells. GFAP is an intermediate-filament protein that is highly expressed in astrocytes and other cells of astroglial lineage. This antibody does not cross-react with brain tissue or extracts from mouse or rat.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells after transplantation into a mouse brain

STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells after transplantation into a mouse brain
STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells after transplantation into a mouse brain.

Back

STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells in vitro

STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells in vitro
STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells in vitro.
MK301 TRACP and ALP Assay Kit 500 Rxns USD $477.00

TRACP & ALP Assay Kit allows for simultaneous detection of 2 enzymes which are involved in bone metabolism. TRACP which is an osteoclast enzyme marker and ALP an osteoblast enzyme marker. TRACP & ALP Assay Kit has been designed for simple and quick detection of ACP (Acid phosphatase) and ALP (Alkaline phosphatase) through the use of pNPP (p-nitro-phenyl phosphate) substrate. The addition of tartaric acid into the ACP assay, allows for the detection of TRACP (tartrate-resistant acid phosphatase) activity. Since this kit utilizes an aqueous substrate, it enables quick activity quantification by measuring the absorbance of the reactant. In addition to this kit, TRACP & ALP double-staining Kit (Cat. #MK300) is also available using a non-soluble substrate. The appropriate kit can be selected depending on assay interest.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK301: TRACP and ALP Assay Kit

MK301: TRACP and ALP Assay Kit
MK300 TRACP and ALP Double-Stain Kit 120 Wells USD $380.00

This product is a staining kit for bone-related cells. Chromogenic substrates for alkaline phosphatase, an enzyme marker of osteoblasts, and tartrate-resistant acid phosphatase, an enzyme marker of osteoclasts, are combined with a reagent for nuclear staining that provides visualization of multinucleated osteoclasts. Both acid and alkaline phosphatase activities in the cells can be stained simultaneously for comparison. Moreover, as the substrates are provided as premixed reagents, the substrate solutions can be easily prepared.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF) and +Vitamin D3

Human bone marrow mononuclear cells were cultured in the presence of  Macrophage Colony Stimulating Factor (+M-CSF) and +Vitamin D3
Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF) and +Vitamin D3. TRACP activity staining was carried out after cells were differentiated on day 9 of the culture.

Back

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF)

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF)
Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF). ALP activity staining was carried out after cells were differentiated on day 9 of the culture.
MK118 Undercarboxylated Osteocalcin (Glu-OC) EIA Kit 96 Rxns USD $866.00

The Undercarboxylated Osteocalcin (Glu-OC) EIA Kit uses two monoclonal antibodies that are highly specific for undercarboxylated osteocalcin (Glu-OC); one of these antibodies is attached to the assay plate and the other is peroxidase-linked. Direct measurement of Glu-OC by the Undercarboxylated Osteocalcin (Glu-OC) EIA Kit provides accurate bone metabolism data without the need for radioactivity. Furthermore, the Undercarboxylated Osteocalcin (Glu-OC) EIA Kit can be used in conjunction with the Gla-Type Osteocalcin (Gla-OC) EIA Kit (Cat. #MK111) to obtain more complete bone metabolism data.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK118: Undercarboxylated Osteocalcin (Glu-OC) EIA Kit

MK118: Undercarboxylated Osteocalcin (Glu-OC) EIA Kit
MK410 Universal Tyrosine Kinase Assay Kit 96 Assays USD $380.00

Universal Tyrosine Kinase Assay Kit enables measurement of the activity of PTK over a wide range, quickly and specifically and with non-RI chemicals. This kit is useful for analysis of the regulation of PTK activity by using recombinant PTK and for the in vitro screening of PTK inhibitors.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Principle of the Universal Tyrosine Assay Kit

Principle of the Universal Tyrosine Assay Kit
Principle of the Universal Tyrosine Assay Kit.

Takara Bio USA, Inc.
United States/Canada: +1.800.662.2566 • Asia Pacific: +1.650.919.7300 • Europe: +33.(0)1.3904.6880 • Japan: +81.(0)77.565.6999
FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES. © 2022 Takara Bio Inc. All Rights Reserved. All trademarks are the property of Takara Bio Inc. or its affiliate(s) in the U.S. and/or other countries or their respective owners. Certain trademarks may not be registered in all jurisdictions. Additional product, intellectual property, and restricted use information is available at takarabio.com.

Takara Bio USA, Inc. provides kits, reagents, instruments, and services that help researchers explore questions about gene discovery, regulation, and function. As a member of the Takara Bio Group, TBUSA is part of a company that holds a leadership position in the global market and is committed to improving the human condition through biotechnology. Our mission is to develop high-quality innovative tools and services to accelerate discovery.

FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES (EXCEPT AS SPECIFICALLY NOTED).

Support
  • Contact us
  • Technical support
  • Customer service
  • Shipping & delivery
  • Sales
  • Feedback
Products
  • New products
  • Special offers
  • Instrument & reagent services
Learning centers
  • NGS
  • Gene function
  • Stem cell research
  • Protein research
  • PCR
  • Cloning
  • Nucleic acid purification
About
  • Our brands
  • Careers
  • Events
  • Blog
  • Need help?
  • Announcements
  • Quality and compliance
  • That's Good Science!
Facebook Twitter  LinkedIn

©2023 Takara Bio Inc. All Rights Reserved.

Region - North America Privacy Policy Terms and Conditions Terms of Use

Top



  • COVID-19 research
  • Viral detection with qPCR
  • SARS-CoV-2 pseudovirus
  • Human ACE2 stable cell line
  • Viral RNA isolation
  • Viral and host sequencing
  • Vaccine development
  • CRISPR screening
  • Drug discovery
  • Immune profiling
  • Publications
  • Next-generation sequencing
  • RNA-seq
  • DNA-seq
  • Single-cell NGS automation
  • Reproductive health
  • Bioinformatics tools
  • Whole genome amplification
  • Immune profiling
  • Diagnostic solutions
  • Reproductive health
  • Real-time PCR
  • Real-time PCR kits
  • Reverse transcription prior to qPCR
  • High-throughput qPCR solutions
  • RNA extraction and analysis for real-time qPCR
  • Stem cell research
  • Media and supplements
  • Stem cells and stem cell-derived cells
  • Single-cell cloning of edited hiPS cells
  • mRNA and cDNA synthesis
  • In vitro transcription
  • cDNA synthesis kits
  • Reverse transcriptases
  • RACE kits
  • Purified cDNA & genomic DNA
  • Purified total RNA and mRNA
  • PCR
  • Most popular polymerases
  • High-yield PCR
  • High-fidelity PCR
  • GC rich PCR
  • PCR master mixes
  • Cloning
  • In-Fusion seamless cloning
  • Competent cells
  • Ligation kits
  • Restriction enzymes
  • Nucleic acid purification
  • Plasmid purification kits
  • Genomic DNA purification kits
  • DNA cleanup kits
  • RNA purification kits
  • Cell-free DNA purification kits
  • Microbiome
  • Gene function
  • Gene editing
  • Viral transduction
  • Fluorescent proteins
  • T-cell transduction and culture
  • Tet-inducible expression systems
  • Transfection reagents
  • Cell biology assays
  • Protein research
  • Purification products
  • Two-hybrid and one-hybrid systems
  • Mass spectrometry reagents
  • Antibodies and ELISAs
  • Primary antibodies and ELISAs by research area
  • Fluorescent protein antibodies
  • New products
  • Special offers
  • Try BcaBEST DNA Polymerase ver.2.0
  • RNA purification sale
  • Capturem IP and Co-IP sale
  • Baculovirus titration kits early access program
  • NGS bundle and save
  • Free sample: PrimePath Direct Saliva SARS-CoV-2 Detection Kit
  • TALON his-tag purification resin special offer
  • GoStix Plus special offers
  • PCR samples
  • Instrument services
  • Apollo services
  • ICELL8 services
  • SmartChip services
  • OEM & custom enzyme manufacturing
  • Services
  • Quality
  • Expertise
  • OEM enzyme FAQs
  • Custom enzyme samples
  • Exploring OEM and custom enzyme partnerships
  • Stem cell services
  • Clinical-grade stem cell services
  • Research-grade stem cell services
  • Outsourcing stem cell-based disease model development
  • Gene and cell therapy manufacturing services
  • Services
  • Facilities
  • Our process
  • Resources
  • Customer service
  • Sales
  • Make an appointment with your sales rep
  • Shipping & delivery
  • Technical support
  • Feedback
  • Online tools
  • GoStix Plus FAQs
  • Partnering & Licensing
  • Vector information
  • Vector document overview
  • Vector document finder
Takara Bio's award-winning GMP-compliant manufacturing facility in Kusatsu, Shiga, Japan.

Partner with Takara Bio!

Takara Bio is proud to offer GMP-grade manufacturing capabilities at our award-winning facility in Kusatsu, Shiga, Japan.

  • Automation systems
  • SmartChip Real-Time PCR System introduction
  • ICELL8 introduction
  • Next-generation sequencing
  • Technical notes
  • Featured kits
  • Technology and application overviews
  • FAQs and tips
  • DNA-seq protocols
  • Bioinformatics resources
  • Webinars
  • cDNA synthesis
  • Real-time PCR
  • Overview
  • Reaction size guidelines
  • Guest webinar: extraction-free SARS-CoV-2 detection
  • Guest webinar: developing and validating molecular diagnostic tests
  • Technical notes
  • Nucleic acid purification
  • Nucleic acid extraction webinars
  • Product demonstration videos
  • Product finder
  • Plasmid kit selection guide
  • RNA purification kit finder
  • PCR
  • Citations
  • Selection guides
  • Technical notes
  • FAQ
  • Cloning
  • In-Fusion Cloning general information
  • Primer design and other tools
  • In‑Fusion Cloning tips and FAQs
  • Applications and technical notes
  • Stem cell research
  • Overview
  • Protocols
  • Technical notes
  • Gene function
  • Gene editing
  • Viral transduction
  • T-cell transduction and culture
  • Inducible systems
  • Cell biology assays
  • Protein research
  • Capturem technology
  • Antibody immunoprecipitation
  • His-tag purification
  • Other tag purification
  • Expression systems
  • Antibodies and ELISA
  • Molecular diagnostics
  • Interview: adapting to change with Takara Bio
  • Applications
  • Solutions
  • Partnering
  • Webinar: Speeding up diagnostic development
  • Contact us
  • Vaccine development
  • Characterizing the viral genome and host response
  • Identifying and cloning vaccine targets
  • Expressing and purifying vaccine targets
  • Immunizing mice and optimizing vaccine targets
  • Pathogen detection
  • Sample prep
  • Detection methods
  • Identification and characterization
  • SARS-CoV-2
  • Antibiotic-resistant bacteria
  • Food crop pathogens
  • Waterborne disease outbreaks
  • Viral-induced cancer
  • Immunotherapy research
  • T-cell therapy
  • Antibody therapeutics
  • T-cell receptor profiling
  • TBI initiatives in cancer therapy
  • Cancer research
  • Sample prep from FFPE tissue
  • Sample prep from plasma
  • Cancer biomarker discovery
  • Cancer biomarker quantification
  • Single cancer cell analysis
  • Cancer genomics and epigenomics
  • HLA typing in cancer
  • Gene editing for cancer therapy/drug discovery
  • Alzheimer's disease research
  • Antibody engineering
  • Sample prep from FFPE tissue
  • Single-cell sequencing
  • Reproductive health technologies
  • Preimplantation genetic testing
  • ESM Collection Kit forms
Create a web account with us

Log in to enjoy additional benefits

Want to save this information?

An account with takarabio.com entitles you to extra features such as:

•  Creating and saving shopping carts
•  Keeping a list of your products of interest
•  Saving all of your favorite pages on the site*
•  Accessing restricted content

*Save favorites by clicking the star () in the top right corner of each page while you're logged in.

Create an account to get started

  • BioView blog
  • Automation
  • Cancer research
  • Career spotlights
  • Current events
  • Customer stories
  • Gene editing
  • Research news
  • Single-cell analysis
  • Stem cell research
  • Tips and troubleshooting
  • Women in STEM
  • That's Good Support!
  • About our blog
  • That's Good Science!
  • SMART-Seq Pro Biomarker Discovery Contest
  • DNA Day 2022
  • That's Good Science Podcast
  • Season one
  • Season two
  • Season three
  • Our brands
  • Takara
  • Clontech
  • Cellartis
  • Our history
  • Announcements
  • Events
  • Biomarker discovery events
  • Calendar
  • Conferences
  • Speak with us
  • Careers
  • Company benefits
  • Trademarks
  • License statements
  • Quality statement
  • Takara Bio affiliates & distributors
  • United States and Canada
  • China
  • Japan
  • Korea
  • Europe
  • India
  • Affiliates & distributors, by country
  • Need help?
  • Privacy request
  • Website FAQs

That's GOOD Science!

What does it take to generate good science? Careful planning, dedicated researchers, and the right tools. At Takara Bio, we thoughtfully develop best-in-class products to tackle your most challenging research problems, and have an expert team of technical support professionals to help you along the way, all at superior value.

Explore what makes good science possible

 Customer Login
 View Cart (0)
  • Home
  • Products
  • Services & Support
  • Learning centers
  • APPLICATIONS
  • About
  • Contact Us
  •  Customer Login
  • Register
  •  View Cart (0)

Takara Bio USA, Inc. provides kits, reagents, instruments, and services that help researchers explore questions about gene discovery, regulation, and function. As a member of the Takara Bio Group, TBUSA is part of a company that holds a leadership position in the global market and is committed to improving the human condition through biotechnology. Our mission is to develop high-quality innovative tools and services to accelerate discovery.

FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES (EXCEPT AS SPECIFICALLY NOTED).

Clontech, TaKaRa, cellartis

  • Products
  • COVID-19 research
  • Next-generation sequencing
  • Diagnostic solutions
  • Real-time PCR
  • Stem cell research
  • mRNA and cDNA synthesis
  • PCR
  • Cloning
  • Nucleic acid purification
  • Gene function
  • Protein research
  • Antibodies and ELISA
  • New products
  • Special offers
  • COVID-19 research
  • Viral detection with qPCR
  • SARS-CoV-2 pseudovirus
  • Human ACE2 stable cell line
  • Viral RNA isolation
  • Viral and host sequencing
  • Vaccine development
  • CRISPR screening
  • Drug discovery
  • Immune profiling
  • Publications
  • Next-generation sequencing
  • RNA-seq
  • DNA-seq
  • Single-cell NGS automation
  • Reproductive health
  • Bioinformatics tools
  • Whole genome amplification
  • Immune profiling
  • Diagnostic solutions
  • Reproductive health
  • Real-time PCR
  • Real-time PCR kits
  • Reverse transcription prior to qPCR
  • High-throughput qPCR solutions
  • RNA extraction and analysis for real-time qPCR
  • Stem cell research
  • Media and supplements
  • Stem cells and stem cell-derived cells
  • Single-cell cloning of edited hiPS cells
  • mRNA and cDNA synthesis
  • In vitro transcription
  • cDNA synthesis kits
  • Reverse transcriptases
  • RACE kits
  • Purified cDNA & genomic DNA
  • Purified total RNA and mRNA
  • PCR
  • Most popular polymerases
  • High-yield PCR
  • High-fidelity PCR
  • GC rich PCR
  • PCR master mixes
  • Cloning
  • In-Fusion seamless cloning
  • Competent cells
  • Ligation kits
  • Restriction enzymes
  • Nucleic acid purification
  • Plasmid purification kits
  • Genomic DNA purification kits
  • DNA cleanup kits
  • RNA purification kits
  • Cell-free DNA purification kits
  • Microbiome
  • Gene function
  • Gene editing
  • Viral transduction
  • Fluorescent proteins
  • T-cell transduction and culture
  • Tet-inducible expression systems
  • Transfection reagents
  • Cell biology assays
  • Protein research
  • Purification products
  • Two-hybrid and one-hybrid systems
  • Mass spectrometry reagents
  • Antibodies and ELISA
  • Primary antibodies and ELISAs by research area
  • Fluorescent protein antibodies
  • Special offers
  • Try BcaBEST DNA Polymerase ver.2.0
  • RNA purification sale
  • Capturem IP and Co-IP sale
  • Baculovirus titration kits early access program
  • NGS bundle and save
  • Free sample: PrimePath Direct Saliva SARS-CoV-2 Detection Kit
  • TALON his-tag purification resin special offer
  • GoStix Plus special offers
  • PCR samples
  • Services & Support
  • Instrument services
  • OEM & custom enzyme manufacturing
  • Stem cell services
  • Gene and cell therapy manufacturing
  • Customer service
  • Sales
  • Shipping & delivery
  • Technical support
  • Feedback
  • Online tools
  • Partnering & Licensing
  • Vector information
  • Instrument services
  • Apollo services
  • ICELL8 services
  • SmartChip services
  • OEM & custom enzyme manufacturing
  • Services
  • Quality
  • Expertise
  • OEM enzyme FAQs
  • Custom enzyme samples
  • Exploring OEM and custom enzyme partnerships
  • Stem cell services
  • Clinical-grade stem cell services
  • Research-grade stem cell services
  • Outsourcing stem cell-based disease model development
  • Gene and cell therapy manufacturing
  • Services
  • Facilities
  • Our process
  • Resources
  • Sales
  • Make an appointment with your sales rep
  • Online tools
  • GoStix Plus FAQs
  • Vector information
  • Vector document overview
  • Vector document finder
  • Learning centers
  • Automation systems
  • Next-generation sequencing
  • cDNA synthesis
  • Real-time PCR
  • Nucleic acid purification
  • PCR
  • Cloning
  • Stem cell research
  • Gene function
  • Protein research
  • Antibodies and ELISA
  • Automation systems
  • SmartChip Real-Time PCR System introduction
  • ICELL8 introduction
  • Next-generation sequencing
  • Technical notes
  • Featured kits
  • Technology and application overviews
  • FAQs and tips
  • DNA-seq protocols
  • Bioinformatics resources
  • Webinars
  • Real-time PCR
  • Overview
  • Reaction size guidelines
  • Guest webinar: extraction-free SARS-CoV-2 detection
  • Guest webinar: developing and validating molecular diagnostic tests
  • Technical notes
  • Nucleic acid purification
  • Nucleic acid extraction webinars
  • Product demonstration videos
  • Product finder
  • Plasmid kit selection guide
  • RNA purification kit finder
  • PCR
  • Citations
  • Selection guides
  • Technical notes
  • FAQ
  • Cloning
  • In-Fusion Cloning general information
  • Primer design and other tools
  • In‑Fusion Cloning tips and FAQs
  • Applications and technical notes
  • Stem cell research
  • Overview
  • Protocols
  • Technical notes
  • Gene function
  • Gene editing
  • Viral transduction
  • T-cell transduction and culture
  • Inducible systems
  • Cell biology assays
  • Protein research
  • Capturem technology
  • Antibody immunoprecipitation
  • His-tag purification
  • Other tag purification
  • Expression systems
  • APPLICATIONS
  • Molecular diagnostics
  • Vaccine development
  • Pathogen detection
  • Immunotherapy research
  • Cancer research
  • Alzheimer's disease research
  • Reproductive health technologies
  • Molecular diagnostics
  • Interview: adapting to change with Takara Bio
  • Applications
  • Solutions
  • Partnering
  • Webinar: Speeding up diagnostic development
  • Contact us
  • Vaccine development
  • Characterizing the viral genome and host response
  • Identifying and cloning vaccine targets
  • Expressing and purifying vaccine targets
  • Immunizing mice and optimizing vaccine targets
  • Pathogen detection
  • Sample prep
  • Detection methods
  • Identification and characterization
  • SARS-CoV-2
  • Antibiotic-resistant bacteria
  • Food crop pathogens
  • Waterborne disease outbreaks
  • Viral-induced cancer
  • Immunotherapy research
  • T-cell therapy
  • Antibody therapeutics
  • T-cell receptor profiling
  • TBI initiatives in cancer therapy
  • Cancer research
  • Sample prep from FFPE tissue
  • Sample prep from plasma
  • Cancer biomarker discovery
  • Cancer biomarker quantification
  • Single cancer cell analysis
  • Cancer genomics and epigenomics
  • HLA typing in cancer
  • Gene editing for cancer therapy/drug discovery
  • Alzheimer's disease research
  • Antibody engineering
  • Sample prep from FFPE tissue
  • Single-cell sequencing
  • Reproductive health technologies
  • Preimplantation genetic testing
  • ESM Collection Kit forms
  • About
  • BioView blog
  • That's Good Science!
  • Our brands
  • Our history
  • Announcements
  • Events
  • Careers
  • Trademarks
  • License statements
  • Quality and compliance
  • Takara Bio affiliates & distributors
  • Need help?
  • Website FAQs
  • BioView blog
  • Automation
  • Cancer research
  • Career spotlights
  • Current events
  • Customer stories
  • Gene editing
  • Research news
  • Single-cell analysis
  • Stem cell research
  • Tips and troubleshooting
  • Women in STEM
  • That's Good Support!
  • About our blog
  • That's Good Science!
  • SMART-Seq Pro Biomarker Discovery Contest
  • DNA Day 2022
  • That's Good Science Podcast
  • Season one
  • Season two
  • Season three
  • Our brands
  • Takara
  • Clontech
  • Cellartis
  • Events
  • Biomarker discovery events
  • Calendar
  • Conferences
  • Speak with us
  • Careers
  • Company benefits
  • Takara Bio affiliates & distributors
  • United States and Canada
  • China
  • Japan
  • Korea
  • Europe
  • India
  • Affiliates & distributors, by country
  • Need help?
  • Privacy request
  • Products
  • Services & Support
  • Learning centers
  • APPLICATIONS
  • About
  • Contact Us