We use cookies to improve your browsing experience and provide meaningful content. Read our cookie policy. Accept
  •  Customer Login
  • Register
  •  View Cart (0)
  •  Customer Login
  • Register
  •  View Cart (0)

  • Products
  • Services & Support
  • Learning centers
  • APPLICATIONS
  • About
  • Contact Us

Close

  • ‹ Back to Bone research
  • Bone specific alkaline phosphatase
  • Collagen type 2
  • Dentin matrix protein 1
  • Osteocalcin (bovine)
  • Osteocalcin (human)
  • Osteocalcin (mouse)
  • Osteocalcin (pig)
  • Osteocalcin (rat)
  • Osteocalcin carboxylated Gla-OC
  • Osteocalcin undercarboxylated Glu-OC
  • Osteonectin
  • Procollagen type I C-peptide
  • Tartrate-resistant acid phosphatase (TRACP)
Home › Products › Antibodies and ELISA › Primary antibodies and ELISAs by research area › Bone research › Tartrate-resistant acid phosphatase (TRACP)

Primary antibodies and ELISAs by research area

  • Bone research
    • Bone specific alkaline phosphatase
    • Collagen type 2
    • Dentin matrix protein 1
    • Osteocalcin (bovine)
    • Osteocalcin (human)
    • Osteocalcin (mouse)
    • Osteocalcin (pig)
    • Osteocalcin (rat)
    • Osteocalcin carboxylated Gla-OC
    • Osteocalcin undercarboxylated Glu-OC
    • Osteonectin
    • Procollagen type I C-peptide
    • Tartrate-resistant acid phosphatase (TRACP)
  • Cell adhesion and ECM
    • Cadherin
    • Calpastatin
    • Fibronectin
    • Heparan degrading enzyme
    • Laminin
    • Vitronectin
    • von Willebrand factor
  • Epigenetic antibodies
    • Histone
  • Metabolic diseases
    • Glucagon
    • Insulin
  • Signal transduction
    • Albumin
    • GMP-140
    • Universal tyrosine kinase
  • Stem cell research antibodies
    • Cellect pluripotent cell antibodies
    • Hepatic cell differentiation antibodies
    • Neural progenitor cell antibodies
    • STEM antibodies
  • Virus research
    • Influenza
  • Miscellaneous research areas
    • Primary antibodies A-K
      • Ago2
      • Bromodeoxyuridine
    • Primary antibodies L-Z
      • Protein S
      • Trigger Factor
Need help?
Contact Sales

Tartrate-resistant acid phosphatase (TRACP) and alkaline phosphatase (ALP) detection

Bone metabolism is mutually balanced between osteoblast-mediated bone formation and osteoclast-mediated bone resorption. Two enzymes involved in bone metabolism, tartrate-resistant acid phosphatase (TRACP) and alkaline phosphatase (ALP), are used as markers of osteoclasts and osteoblasts, respectively.

TRACP is expressed in osteoclasts, neurons, and activated macrophages. Overexpression of TRACP has been associated with disease states such as Gaucher's disease, B- and T-cell leukemias, and osteoporosis. TRACP and ALP staining enables effective discrimination between osteoblast and osteoclast bone cells.

Bone metabolism is mutually balanced between osteoblast-mediated bone formation and osteoclast-mediated bone resorption. Two enzymes involved in bone metabolism, tartrate-resistant acid phosphatase (TRACP) and alkaline phosphatase (ALP), are used as markers of osteoclasts and osteoblasts, respectively.

TRACP is expressed in osteoclasts, neurons, and activated macrophages. Overexpression of TRACP has been associated with disease states such as Gaucher's disease, B- and T-cell leukemias, and osteoporosis. TRACP and ALP staining enables effective discrimination between osteoblast and osteoclast bone cells.

Alternate name for TRACP include TRAP, tartrate-resistant acid phosphatase type 5, TR-AP, trATPase, acid phosphatase type V, type 5 acid phosphatase, and tartrate-resistant acid ATPase.

Alternate names for ALP include AKP2, alkaline phosphatase, alkaline phosphatase liver/bone/kidney isozyme antibody, Alpl, AP-TNAP, HOPS, Liver/bone/kidney isozyme, PHOA, PPBT_HUMAN, tissue nonspecific alkaline phosphatase, tissue nonspecific ALP, tissue-nonspecific isozyme, TNAP, and TNSALP.

Kits for TRACP and ALP detection

The TRACP and ALP Double Stain Kit (Cat. # MK300) combines the non-soluble, chromogenic substrates for ALP and TRACP with a nuclear staining reagent. This enables osteoblast and osteoclast detection due to the simultaneous cell staining for both alkaline and acid phosphatase activities. Detection of both enzyme markers provides a means to study the differentiation of bone cells. The kit substrates are provided as premixed reagents for ease of use. Sufficient reagents are supplied for staining approximately five culture plates (24-well format).

An alternative option for the study of bone metabolism is the TRACP and ALP Assay Kit (Cat. # MK301), which contains a soluble substrate that is quickly assayed by absorbance measurement. Either bone metabolism kit may be selected depending on user interest.

The TRACP and ALP Assay Kit allows for the simultaneous detection of both ACP (acid phosphatase) and ALP (alkaline phosphatase) enzymes via pNPP (p-nitro-phenyl phosphate) substrate. The addition of tartaric acid into the ACP assay allows for differentiation of TRACP from ALP activity. Because the TRACP and ALP Assay Kit utilizes an aqueous substrate, quantification of enzyme activities can be accomplished quickly by measuring the absorbance of the reactant.

Antibody for ALP detection

The Bone Specific Alkaline Phosphatase (Rat), Polyclonal antibody (Cat. # M190) was raised against a conjugate of the KLH immunogen and the peptide (20–49), which is highly conserved between human and rat bone-specific ALP. The antibody is suitable for Western blot (WB) analysis (in non-reducing conditions) and immunohistochemical (IHC) detection of paraffin-embedded tissue sections (no antigen retrieval needed).

 More  Less
Cat. # Product Size License Quantity Details
MK301 TRACP and ALP Assay Kit 500 Rxns USD $445.00

TRACP & ALP Assay Kit allows for simultaneous detection of 2 enzymes which are involved in bone metabolism. TRACP which is an osteoclast enzyme marker and ALP an osteoblast enzyme marker. TRACP & ALP Assay Kit has been designed for simple and quick detection of ACP (Acid phosphatase) and ALP (Alkaline phosphatase) through the use of pNPP (p-nitro-phenyl phosphate) substrate. The addition of tartaric acid into the ACP assay, allows for the detection of TRACP (tartrate-resistant acid phosphatase) activity. Since this kit utilizes an aqueous substrate, it enables quick activity quantification by measuring the absorbance of the reactant. In addition to this kit, TRACP & ALP double-staining Kit (Cat. #MK300) is also available using a non-soluble substrate. The appropriate kit can be selected depending on assay interest.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK301: TRACP and ALP Assay Kit

MK301: TRACP and ALP Assay Kit
MK300 TRACP and ALP Double-Stain Kit 120 Wells USD $355.00

This product is a staining kit for bone-related cells. Chromogenic substrates for alkaline phosphatase, an enzyme marker of osteoblasts, and tartrate-resistant acid phosphatase, an enzyme marker of osteoclasts, are combined with a reagent for nuclear staining that provides visualization of multinucleated osteoclasts. Both acid and alkaline phosphatase activities in the cells can be stained simultaneously for comparison. Moreover, as the substrates are provided as premixed reagents, the substrate solutions can be easily prepared.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF) and +Vitamin D3

Human bone marrow mononuclear cells were cultured in the presence of  Macrophage Colony Stimulating Factor (+M-CSF) and +Vitamin D3
Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF) and +Vitamin D3. TRACP activity staining was carried out after cells were differentiated on day 9 of the culture.

Back

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF)

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF)
Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF). ALP activity staining was carried out after cells were differentiated on day 9 of the culture.
M190 Bone Specific Alkaline Phosphatase (Rat), Polyclonal 0.1 mg USD $487.00

This product was raised against conjugate of KLH and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] that illustrates an exceptional homology with human and rat Bone Specific Alkaline Phosphatase.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

Overview

Antigen/peptide
Cat. #
Application
Species
Assay type
Kit description
TRACP and ALP MK300 Differential staining of TRAP and ALP activities in bone cells

Osteoblast and osteoclast detection
Human, Mouse, Rat, Rabbit Double stain of intracellular TRACP and ALP plus nuclear stain Staining kit for bone‑related cells distinguishes activity of osteoblasts (ALP) from that of osteoclasts (TRACP)
TRACP and ALP MK301 Detection of TRACP and ALP enzyme activities Human, Rabbit Soluble substrates provided to assay TRACP and ALP activities Colorimetric assay kit for bone-related cells distinguishes activity of osteoblasts (ALP) from that of osteoclasts (TRACP)

Antigen/peptide Cat. # Application Species (Clone) and source Cross‑reactivity
ALP (20–49) conjugated with KLH M190 IHC, WB Rat (n/a)
Rabbit IgG PoAb
Cross-reacts with mouse ALP

Slight cross‑reactivity with human ALP

More Information

Please see the product's Certificate of Analysis for information about storage conditions, product components, and technical specifications. Please see the Kit Components List to determine kit components. Certificates of Analysis and Kit Components Lists are located under the Documents tab.

Takara Bio USA, Inc.
United States/Canada: +1.800.662.2566 • Asia Pacific: +1.650.919.7300 • Europe: +33.(0)1.3904.6880 • Japan: +81.(0)77.565.6999
FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES. © 2022 Takara Bio Inc. All Rights Reserved. All trademarks are the property of Takara Bio Inc. or its affiliate(s) in the U.S. and/or other countries or their respective owners. Certain trademarks may not be registered in all jurisdictions. Additional product, intellectual property, and restricted use information is available at takarabio.com.

Takara Bio USA, Inc. provides kits, reagents, instruments, and services that help researchers explore questions about gene discovery, regulation, and function. As a member of the Takara Bio Group, TBUSA is part of a company that holds a leadership position in the global market and is committed to improving the human condition through biotechnology. Our mission is to develop high-quality innovative tools and services to accelerate discovery.

FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES (EXCEPT AS SPECIFICALLY NOTED).

Support
  • Contact us
  • Technical support
  • Customer service
  • Shipping & delivery
  • Sales
  • Feedback
Products
  • New products
  • Special offers
  • Instrument & reagent services
Learning centers
  • NGS
  • Gene function
  • Stem cell research
  • Protein research
  • PCR
  • Cloning
  • Nucleic acid purification
About
  • Our brands
  • Careers
  • Events
  • Blog
  • Need help?
  • Announcements
  • Quality and compliance
  • That's Good Science!
Facebook Twitter  LinkedIn

©2022 Takara Bio Inc. All Rights Reserved.

Region - North America Privacy Policy Terms and Conditions Terms of Use

Top



  • COVID-19 research
  • Viral detection with qPCR
  • SARS-CoV-2 pseudovirus
  • Human ACE2 stable cell line
  • Viral RNA isolation
  • Viral and host sequencing
  • Vaccine development
  • CRISPR screening
  • Drug discovery
  • Immune profiling
  • Publications
  • Next-generation sequencing
  • RNA-seq
  • DNA-seq
  • Single-cell NGS automation
  • Whole genome amplification
  • Immune profiling
  • Real-time PCR
  • Real-time PCR kits
  • Reverse transcription prior to qPCR
  • High-throughput qPCR solutions
  • RNA extraction and analysis for real-time qPCR
  • Stem cell research
  • Media and supplements
  • Stem cells and stem cell-derived cells
  • Single-cell cloning of edited hiPS cells
  • mRNA and cDNA synthesis
  • In vitro transcription
  • cDNA synthesis kits
  • Reverse transcriptases
  • RACE kits
  • Purified cDNA & genomic DNA
  • Purified total RNA and mRNA
  • PCR
  • Most popular polymerases
  • High-yield PCR
  • High-fidelity PCR
  • GC rich PCR
  • PCR master mixes
  • Cloning
  • In-Fusion seamless cloning
  • Competent cells
  • Ligation kits
  • Restriction enzymes
  • Nucleic acid purification
  • Plasmid purification kits
  • Genomic DNA purification kits
  • DNA cleanup kits
  • RNA purification kits
  • Microbiome
  • Gene function
  • Gene editing
  • Viral transduction
  • Fluorescent proteins
  • T-cell transduction and culture
  • Tet-inducible expression systems
  • Transfection reagents
  • Cell biology assays
  • Protein research
  • Purification products
  • Two-hybrid and one-hybrid systems
  • Mass spectrometry reagents
  • Antibodies and ELISAs
  • Primary antibodies and ELISAs by research area
  • Fluorescent protein antibodies
  • New products
  • Special offers
  • Plasmid and nucleic acid prep promo
  • Stellar Competent Cells special offer
  • PCR samples
  • Instrument services
  • Apollo services
  • ICELL8 services
  • SmartChip services
  • OEM & custom enzyme manufacturing
  • Services
  • Quality
  • Expertise
  • OEM enzyme FAQs
  • Custom enzyme samples
  • Exploring OEM and custom enzyme partnerships
  • Stem cell services
  • Clinical-grade stem cell services
  • Research-grade stem cell services
  • Outsourcing stem cell-based disease model development
  • Gene and cell therapy manufacturing services
  • Services
  • Facilities
  • Our process
  • Resources
  • Customer service
  • Sales
  • Make an appointment with your sales rep
  • Shipping & delivery
  • Technical support
  • Feedback
  • Online tools
  • GoStix Plus FAQs
  • Partnering & Licensing
  • Vector information
  • Vector document overview
  • Vector document finder
Takara Bio's award-winning GMP-compliant manufacturing facility in Kusatsu, Shiga, Japan.

Partner with Takara Bio!

Takara Bio is proud to offer GMP-grade manufacturing capabilities at our award-winning facility in Kusatsu, Shiga, Japan.

  • Automation systems
  • SmartChip Real-Time PCR System introduction
  • ICELL8 introduction
  • Next-generation sequencing
  • Technical notes
  • Featured kits
  • Technology and application overviews
  • FAQs and tips
  • DNA-seq protocols
  • Bioinformatics resources
  • Webinars
  • cDNA synthesis
  • Real-time PCR
  • Overview
  • Reaction size guidelines
  • Technical notes
  • Nucleic acid purification
  • Nucleic acid extraction webinars
  • Product demonstration videos
  • Product finder
  • Plasmid kit selection guide
  • RNA purification kit finder
  • PCR
  • Citations
  • Selection guides
  • Technical notes
  • FAQ
  • Cloning
  • In-Fusion Cloning general information
  • Primer design and other tools
  • In‑Fusion Cloning tips and FAQs
  • Applications and technical notes
  • Stem cell research
  • Overview
  • Protocols
  • Technical notes
  • Gene function
  • Gene editing
  • Viral transduction
  • T-cell transduction and culture
  • Inducible systems
  • Cell biology assays
  • Protein research
  • Capturem technology
  • Antibody purification and immunoprecipitation
  • His-tag purification
  • Other tag purification
  • Expression systems
  • Antibodies and ELISA
  • Molecular diagnostics
  • Applications
  • Solutions
  • Partnering
  • Webinar: Speeding up diagnostic development
  • Contact us
  • Vaccine development
  • Characterizing the viral genome and host response
  • Identifying and cloning vaccine targets
  • Expressing and purifying vaccine targets
  • Immunizing mice and optimizing vaccine targets
  • Pathogen detection
  • Sample prep
  • Detection methods
  • Identification and characterization
  • SARS-CoV-2
  • Antibiotic-resistant bacteria
  • Food crop pathogens
  • Waterborne disease outbreaks
  • Viral-induced cancer
  • Immunotherapy research
  • T-cell therapy
  • Antibody therapeutics
  • T-cell receptor profiling
  • TBI initiatives in cancer therapy
  • Cancer research
  • Sample prep from FFPE tissue
  • Sample prep from plasma
  • Cancer biomarker discovery
  • Cancer biomarker quantification
  • Single cancer cell analysis
  • Cancer genomics and epigenomics
  • HLA typing in cancer
  • Gene editing for cancer therapy/drug discovery
  • Alzheimer's disease research
  • Antibody engineering
  • Sample prep from FFPE tissue
  • Single-cell sequencing
  • Reproductive health technologies
  • Preimplantation genetic testing
Create a web account with us

Log in to enjoy additional benefits

Want to save this information?

An account with takarabio.com entitles you to extra features such as:

•  Creating and saving shopping carts
•  Keeping a list of your products of interest
•  Saving all of your favorite pages on the site*
•  Accessing restricted content

*Save favorites by clicking the star () in the top right corner of each page while you're logged in.

Create an account to get started

  • BioView blog
  • Automation
  • Cancer research
  • Career spotlights
  • Current events
  • Customer stories
  • Gene editing
  • Research news
  • Single-cell analysis
  • Stem cell research
  • Tips and troubleshooting
  • Women in STEM
  • That's Good Support!
  • About our blog
  • That's Good Science!
  • DNA Day 2022
  • That's Good Science Thursdays
  • That's Good Science Thursdays (2021)
  • That's Good Science Podcast
  • Season one
  • Season two
  • Season three
  • Our brands
  • Takara
  • Clontech
  • Cellartis
  • Our history
  • Announcements
  • Events
  • Biomarker discovery events
  • Calendar
  • Conferences
  • Speak with us
  • Careers
  • Trademarks
  • License statements
  • Quality statement
  • Takara Bio affiliates & distributors
  • United States and Canada
  • China
  • Japan
  • Korea
  • Europe
  • India
  • Affiliates & distributors, by country
  • Need help?
  • Privacy request
  • Website FAQs

That's GOOD Science!

What does it take to generate good science? Careful planning, dedicated researchers, and the right tools. At Takara Bio, we thoughtfully develop best-in-class products to tackle your most challenging research problems, and have an expert team of technical support professionals to help you along the way, all at superior value.

Explore what makes good science possible

 Customer Login
 View Cart (0)
  • Home
  • Products
  • Services & Support
  • Learning centers
  • Applications
  • About
  • Contact us
  •  Customer Login
  • Register
  •  View Cart (0)

Takara Bio USA, Inc. provides kits, reagents, instruments, and services that help researchers explore questions about gene discovery, regulation, and function. As a member of the Takara Bio Group, TBUSA is part of a company that holds a leadership position in the global market and is committed to improving the human condition through biotechnology. Our mission is to develop high-quality innovative tools and services to accelerate discovery.

FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES (EXCEPT AS SPECIFICALLY NOTED).

Clontech, TaKaRa, cellartis

  • Products
  • Next-generation sequencing
  • Gene function
  • Stem cell research
  • Protein research
  • Diagnostic solutions
  • PCR
  • Cloning
  • Nucleic acid purification
  • Antibodies and ELISA
  • Real-time PCR
  • mRNA and cDNA synthesis
  • COVID-19 research
  • Next-generation sequencing
  • RNA-seq
  • DNA-seq
  • Single-cell NGS automation
  • Bioinformatics tools
  • Whole genome amplification
  • Immune profiling
  • Epigenetics and small RNA sequencing
  • NGS accessories
  • Gene function
  • Gene editing
  • Viral transduction
  • Fluorescent proteins
  • T-cell transduction and culture
  • Tet-inducible expression systems
  • ProteoTuner protein control systems
  • iDimerize inducible protein interaction systems
  • Transfection reagents
  • Mammalian expression plasmids
  • Cell biology assays
  • Stem cell research
  • Media and supplements
  • Stem cells and stem cell-derived cells
  • Single-cell cloning of edited hiPS cells
  • Accessories
  • Protein research
  • Purification products
  • Two-hybrid and one-hybrid systems
  • Mass spectrometry reagents
  • Expression vectors & systems
  • Glycobiology
  • Antibodies and immunoprecipitation
  • SDS-PAGE & western blotting
  • Protein sequencing
  • Accessory enzymes
  • Diagnostic solutions
  • SARS-CoV-2 clinical diagnostic tests
  • PCR
  • Most popular polymerases
  • Standard PCR
  • High-yield PCR
  • High-fidelity PCR
  • Fast PCR
  • Long-range PCR
  • GC rich PCR
  • Direct PCR
  • PCR master mixes
  • Custom business friendly and automation-ready solutions
  • Molecular diagnostic products
  • GMP-grade products
  • Application-specific PCR
  • Other PCR-related products
  • PCR thermal cyclers
  • Cloning
  • In-Fusion seamless cloning
  • Competent cells
  • Ligation kits
  • Mutagenesis kits
  • Ligation enzymes
  • Restriction enzymes
  • Modifying enzymes
  • X-Gal and IPTG
  • Linkers, primers, and cloning vectors
  • Agarose gel electrophoresis
  • Nucleic acid extraction
  • Nucleic acid purification
  • Plasmid purification kits
  • Genomic DNA purification kits
  • DNA cleanup kits
  • RNA purification kits
  • RNA cleanup kits
  • Viral DNA and RNA purification kits
  • Microbiome
  • Accessories and components
  • Antibodies and ELISA
  • Primary antibodies and ELISAs by research area
  • Secondary antibodies
  • Antibody and ELISA accessories
  • Fluorescent protein antibodies
  • Real-time PCR
  • Real-time PCR kits
  • Reverse transcription prior to qPCR
  • High-throughput qPCR solutions
  • Real-time PCR primer sets
  • References and standards for qPCR
  • RNA extraction and analysis for real-time qPCR
  • mRNA and cDNA synthesis
  • In vitro transcription
  • cDNA synthesis kits
  • Reverse transcriptases
  • RACE kits
  • Purified cDNA & genomic DNA
  • Purified total RNA and mRNA
  • cDNA synthesis accessories
  • COVID-19 research
  • Viral detection with qPCR
  • SARS-CoV-2 pseudovirus
  • Human ACE2 stable cell line
  • Viral RNA isolation
  • Viral and host sequencing
  • Vaccine development
  • CRISPR screening
  • Drug discovery
  • Immune profiling
  • Publications
  • Services & Support
  • Instrument services
  • OEM & custom enzyme manufacturing
  • Stem cell services
  • Gene and cell therapy manufacturing services
  • Customer service
  • Technical support
  • Sales
  • Shipping & delivery
  • Partnering & Licensing
  • Feedback
  • Webinars from Takara Bio
  • Vector information
  • Online tools
  • Instrument services
  • Apollo services
  • ICELL8 services
  • SmartChip services
  • OEM & custom enzyme manufacturing
  • Services
  • Quality
  • Expertise
  • OEM enzyme FAQs
  • Custom enzyme samples
  • Exploring OEM and custom enzyme partnerships
  • Stem cell services
  • Clinical-grade stem cell services
  • Research-grade stem cell services
  • Outsourcing stem cell-based disease model development
  • Gene and cell therapy manufacturing services
  • Services
  • Facilities
  • Our process
  • Resources
  • Sales
  • Make an appointment with your sales rep
  • Webinars from Takara Bio
  • NGS: biomarkers and oncology
  • NGS: immunology
  • Stem cells
  • Real-time PCR
  • Gene function
  • Protein science
  • Vector information
  • Vector document overview
  • Vector document finder
  • Online tools
  • GoStix Plus FAQs
  • Learning centers
  • Automation systems
  • Next-generation sequencing
  • Gene function
  • Stem cell research
  • Protein research
  • PCR
  • Cloning
  • Nucleic acid purification
  • Antibodies and ELISA
  • Real-time PCR
  • cDNA synthesis
  • Automation systems
  • SmartChip Real-Time PCR System introduction
  • ICELL8 introduction
  • Apollo library prep system introduction
  • Next-generation sequencing
  • Product line overview
  • Technical notes
  • Featured kits
  • Technology and application overviews
  • FAQs and tips
  • DNA-seq protocols
  • Bioinformatics resources
  • Newsletters
  • Webinars
  • Citations
  • Posters
  • Gene function
  • Gene editing
  • Viral transduction
  • T-cell transduction and culture
  • Inducible systems
  • Transfection reagents
  • Fluorescent proteins
  • Cell biology assays
  • Stem cell research
  • Overview
  • Protocols
  • Applications
  • Technical notes
  • Posters
  • Webinars
  • Videos
  • FAQs
  • Citations
  • Selection guides
  • Protein research
  • Capturem technology
  • Antibody purification and immunoprecipitation
  • His-tag purification
  • Other tag purification
  • Phosphoprotein and glycoprotein purification
  • Mass spectrometry digestion reagents
  • Matchmaker Gold yeast two-hybrid systems
  • Expression systems
  • PCR
  • Citations
  • Selection guides
  • PCR enzyme brochure
  • Technical notes
  • FAQ
  • Go green with lyophilized enzymes
  • LA PCR technology
  • Cloning
  • In-Fusion Cloning general information
  • Primer design and other tools
  • In‑Fusion Cloning tips and FAQs
  • Applications and technical notes
  • Sign up to stay updated
  • Traditional molecular cloning
  • Nucleic acid purification
  • Nucleic acid extraction webinars
  • Product demonstration videos
  • Product finder
  • Plasmid kit selection guide
  • Plasmid purification
  • Genomic DNA purification
  • DNA/RNA cleanup and extraction
  • RNA purification
  • RNA purification kit finder
  • Viral DNA and RNA purification
  • Parallel DNA, RNA & protein
  • Automated DNA and RNA purification
  • Accessory selection guides
  • Microbiome
  • Antibodies and ELISA
  • Osteocalcin focus
  • Real-time PCR
  • Overview
  • Product finder
  • Reaction size guidelines
  • Real-time PCR products brochure
  • Real-time PCR tutorial videos
  • Guest webinar: extraction-free SARS-CoV-2 detection
  • Technical notes
  • FAQs
  • cDNA synthesis
  • Premium total and poly A+ RNA
  • SMARTer RACE 5'/3' Kit
  • Cloning antibody variable regions
  • Applications
  • Molecular diagnostics
  • Pathogen detection
  • Vaccine development
  • Cancer research
  • Immunotherapy research
  • Alzheimer's disease research
  • Reproductive health technologies
  • Molecular diagnostics
  • Applications
  • Solutions
  • Partnering
  • Webinar: Speeding up diagnostic development
  • Contact us
  • Pathogen detection
  • Sample prep
  • Detection methods
  • Identification and characterization
  • SARS-CoV-2
  • Antibiotic-resistant bacteria
  • Food crop pathogens
  • Waterborne disease outbreaks
  • Viral-induced cancer
  • Vaccine development
  • Characterizing the viral genome and host response
  • Identifying and cloning vaccine targets
  • Expressing and purifying vaccine targets
  • Immunizing mice and optimizing vaccine targets
  • Cancer research
  • Sample prep from FFPE tissue
  • Sample prep from plasma
  • Cancer biomarker discovery
  • Cancer biomarker quantification
  • Single cancer cell analysis
  • Cancer genomics and epigenomics
  • HLA typing in cancer
  • Gene editing for cancer therapy/drug discovery
  • Immunotherapy research
  • T-cell therapy
  • Antibody therapeutics
  • T-cell receptor profiling
  • TBI initiatives in cancer therapy
  • Alzheimer's disease research
  • Antibody engineering
  • Sample prep from FFPE tissue
  • Single-cell sequencing
  • Reproductive health technologies
  • Preimplantation genetic testing
  • About
  • BioView blog
  • That's Good Science!
  • Our brands
  • Our history
  • Announcements
  • Events
  • Careers
  • Trademarks
  • License statements
  • Quality and compliance
  • Takara Bio affiliates & distributors
  • Need help?
  • Website FAQs
  • DSS Takara Bio India Pvt. Ltd : Manufacturing
  • Our partners
  • Special offers
  • New products
  • BioView blog
  • Automation
  • Cancer research
  • Career spotlights
  • Current events
  • Customer stories
  • Gene editing
  • Research news
  • Single-cell analysis
  • Stem cell research
  • Tips and troubleshooting
  • Women in STEM
  • That's Good Support!
  • About our blog
  • That's Good Science!
  • DNA Day 2022
  • That's Good Science Thursdays
  • That's Good Science Thursdays (2021)
  • That's Good Science Podcast
  • Season one
  • Season two
  • Season three
  • Our brands
  • Takara
  • Clontech
  • Cellartis
  • Events
  • Biomarker discovery events
  • Calendar
  • Conferences
  • Speak with us
  • Takara Bio affiliates & distributors
  • United States and Canada
  • China
  • Japan
  • Korea
  • Europe
  • India
  • Affiliates & distributors, by country
  • Need help?
  • Privacy request
  • Special offers
  • Plasmid and nucleic acid prep promo
  • Stellar Competent Cells special offer
  • PCR samples
  • Lab Essentials
  • Products
  • Services & Support
  • Learning centers
  • APPLICATIONS
  • About
  • Contact Us